SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g18491

Feature Type:gene_model
Chromosome:Gm20
Start:26140049
stop:26141904
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g18491
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G04730AT Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein | chr1:1325385-1331086 REVERSE LENGTH=943 SoyBaseE_val: 4.00E-36ISS
GO:0006261GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent DNA replication SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005657GO-cc Annotation by Michelle Graham. GO Cellular Compartment: replication fork SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
UniRef100_I1NEG6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1NEG6_SOYBN SoyBaseE_val: 1.00E-75ISS
UniRef100_O23013UniRef Annotation by Michelle Graham. Most informative UniRef hit: T1G11.3 n=1 Tax=Arabidopsis thaliana RepID=O23013_ARATH SoyBaseE_val: 5.00E-35ISS

Expression Patterns of Glyma20g18491
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g18491 not represented in the dataset
Glyma20g18491 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g18491 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g075500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g18491
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g18491
>Glyma20g18491.1   sequence type=CDS   gene model=Glyma20g18491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATGATGGAAAAGATGGACATTTTGAATACCTGGCACCACAAAATCCCACCGTATATTGCAAGGAACTTATCAGCTAGTTCCTTTGTTGAAACCTTAATTTCTCCATTATTACATATTTTGTCCCCACCAACTATAAGACCGGTAGCATTTCAATTACTATCAGATAAGGAGAAGAATGATCTTGCTCAATTAGTTAGCACAATGGTGTCATACACTATAACATATAAAACTGTGAAATCAGATATTCTGCCTCAAACCCAGAGGTGTGACGTAGTTGATAGCTTGGCTCGGTCTCTTGTTCCTCCTATTAGCGACTTTATAAATTTGAAGGTTGAAAAGCATAAGATTTTACAAGTTGGTAATGACAAAGCTGGGGCCTTCACAAATATGGAGGGCATGAAGTTATTGAGATTAGAACTAACAACATCCCATTAG
Predicted protein sequences of Glyma20g18491
>Glyma20g18491.1   sequence type=predicted peptide   gene model=Glyma20g18491   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MMMEKMDILNTWHHKIPPYIARNLSASSFVETLISPLLHILSPPTIRPVAFQLLSDKEKNDLAQLVSTMVSYTITYKTVKSDILPQTQRCDVVDSLARSLVPPISDFINLKVEKHKILQVGNDKAGAFTNMEGMKLLRLELTTSH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo