Glyma20g18450 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g18450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g18450): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g18450

Feature Type:	gene_model
Chromosome:	Gm20
Start:	26085201
stop:	26085820
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g18450

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G24660	AT	Annotation by Michelle Graham. TAIR10: homeobox protein 22 \| chr4:12724851-12725513 REVERSE LENGTH=220	SoyBase	E_val: 4.00E-56	ISS
GO:0009686	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellin biosynthetic process	SoyBase	N/A	ISS
GO:0009737	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus	SoyBase	N/A	ISS
GO:0009740	GO-bp	Annotation by Michelle Graham. GO Biological Process: gibberellic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0009845	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed germination	SoyBase	N/A	ISS
GO:0010162	GO-bp	Annotation by Michelle Graham. GO Biological Process: seed dormancy process	SoyBase	N/A	ISS
GO:0048608	GO-bp	Annotation by Michelle Graham. GO Biological Process: reproductive structure development	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF04770	PFAM	ZF-HD protein dimerisation region	JGI		ISS
UniRef100_B0LK12	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Zinc finger homeodomain protein 1 n=1 Tax=Saruma henryi RepID=B0LK12_SARHE	SoyBase	E_val: 5.00E-59	ISS
UniRef100_UPI000233DD1B	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DD1B related cluster n=1 Tax=unknown RepID=UPI000233DD1B	SoyBase	E_val: 9.00E-153	ISS

Expression Patterns of Glyma20g18450

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g18450 not represented in the dataset	Glyma20g18450 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g18450 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g075300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g18450

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g18450

Limit To All Plant Sequences

>Glyma20g18450.2   sequence type=CDS   gene model=Glyma20g18450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCCCAACACCACCCACCCTGGCTCAAAACAACGACAATGAGAAGTATCATGAGTGCCTTAAGAACCACACCATCAAAACTGGTGTCCACACACTTGATGGATGCATCAAGTTCTTGCCTCTAGGCGAGGAGGGAACCCTGGATGCGCTAAAATGCCTCATGTGCAACTGCCACCGAAACTTCCATCGTAAGGAGACCCCCAATTACACCTACCTGGTGCCTTACTACCGCCACTCACCATTGCCATTGGCAGCGTACTATGGGGAGCAGGTGGGCTACCCCCATGTGCAAGGGCAACAATGCACCACACTGGCACTCCCCTCCAGGTCAAGGGGTAGTGGTGGGGCCCAGTCCTCGAGGGAGGACATTGAAGCAGTGTCAGACCCAACGAGTGGTGCCACTCCTCATGGCGGGTCCAGCAAGAAGCGTTTCAGGACTAGGTTCACCCAAGAGCAAAAGGAGAAGATGTTGGCCTTTGCAGAAAAGCTTGGCTGGAGGATTTTGAAGCATGATGAGAGTGCCGTGCAGGAGTTTTGTGCCGAAACTAGCATCCAACCTCATGTGCTTAAGGTGTGGGTGAACAACAACAAGAACACCTTAGGTAAGAAGCTCTAG

Predicted protein sequences of Glyma20g18450

Limit To All Plant Sequences

>Glyma20g18450.2   sequence type=predicted peptide   gene model=Glyma20g18450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTPTPPTLAQNNDNEKYHECLKNHTIKTGVHTLDGCIKFLPLGEEGTLDALKCLMCNCHRNFHRKETPNYTYLVPYYRHSPLPLAAYYGEQVGYPHVQGQQCTTLALPSRSRGSGGAQSSREDIEAVSDPTSGATPHGGSSKKRFRTRFTQEQKEKMLAFAEKLGWRILKHDESAVQEFCAETSIQPHVLKVWVNNNKNTLGKKL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain