SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g18400

Feature Type:gene_model
Chromosome:Gm20
Start:25832843
stop:25834983
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g18400
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
PF12481PFAM Aluminium induced protein JGI ISS
UniRef100_B9T7M8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Stem-specific protein TSJT1, putative n=1 Tax=Ricinus communis RepID=B9T7M8_RICCO SoyBaseE_val: 3.00E-06ISS
UniRef100_I1N8W9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N8W9_SOYBN SoyBaseE_val: 3.00E-40ISS

Expression Patterns of Glyma20g18400
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g18400 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g074900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g18400
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g18400
>Glyma20g18400.1   sequence type=CDS   gene model=Glyma20g18400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTGCCTATATTCCACAAATCTTTTTCTCATCCACCTCAAGAGCTCAACAGCCCTACATCTTACAAAGGTTCCAAGAAGCCTAAGTTATTAGTTGTTATGAGTCTGGAGAGGCATGACACAGATATTGTTGGGTTTGATACCAAAAATACAGTAAGTTATGCAGCTGATGCGTCAAACCTACACGTTGAAGAAAAGAAGTACTCGTATTCTACAAAAGATGGCCATGATGCTAAAAAAATAGGTTTTCAAGAGGCAACACATGAAAGTGTTCATCAACCGAAAAGGACTGCAAAGATTCATGACTTCTATTTAGGCATCCCCTTTGCCTTTGATGAATCTTCTCTCTCCTAA
Predicted protein sequences of Glyma20g18400
>Glyma20g18400.1   sequence type=predicted peptide   gene model=Glyma20g18400   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLPIFHKSFSHPPQELNSPTSYKGSKKPKLLVVMSLERHDTDIVGFDTKNTVSYAADASNLHVEEKKYSYSTKDGHDAKKIGFQEATHESVHQPKRTAKIHDFYLGIPFAFDESSLS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo