SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g18000

Feature Type:gene_model
Chromosome:Gm20
Start:25194909
stop:25197778
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g18000
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
UniRef100_UPI0002336F30UniRef Annotation by Michelle Graham. Best UniRef hit: UPI0002336F30 related cluster n=1 Tax=unknown RepID=UPI0002336F30 SoyBaseE_val: 5.00E-07ISS

Expression Patterns of Glyma20g18000
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g18000 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma20g18000
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g18000
>Glyma20g18000.1   sequence type=CDS   gene model=Glyma20g18000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTAGTGGACATATCAAAGTGGGACCAACATCACTCTCACTTCTTCGCTCTCTCCCTCCTTCCTTCCCACTAGCACTCCTCGATTACCAGGATTATGATAAATTTGGTCTTAGATTCCCAAATTTTAATTTCAATGTATCTCATCATGGTGACTGTGGCCATAGCATCTGA
Predicted protein sequences of Glyma20g18000
>Glyma20g18000.1   sequence type=predicted peptide   gene model=Glyma20g18000   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGSGHIKVGPTSLSLLRSLPPSFPLALLDYQDYDKFGLRFPNFNFNVSHHGDCGHSI*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo