SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma20g17941

Feature Type:gene_model
Chromosome:Gm20
Start:24958509
stop:24959166
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13630AT Annotation by Michelle Graham. TAIR10: magnesium-chelatase subunit chlH, chloroplast, putative / Mg-protoporphyrin IX chelatase, putative (CHLH) | chr5:4387920-4392082 REVERSE LENGTH=1263 SoyBaseE_val: 1.00E-65ISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0015995GO-bp Annotation by Michelle Graham. GO Biological Process: chlorophyll biosynthetic process SoyBaseN/AISS
GO:0019684GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009706GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast inner membrane SoyBaseN/AISS
GO:0010007GO-cc Annotation by Michelle Graham. GO Cellular Compartment: magnesium chelatase complex SoyBaseN/AISS
GO:0016851GO-mf Annotation by Michelle Graham. GO Molecular Function: magnesium chelatase activity SoyBaseN/AISS
PF11965PFAM Domain of unknown function (DUF3479) JGI ISS
UniRef100_I1JND2UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JND2_SOYBN SoyBaseE_val: 3.00E-80ISS
UniRef100_O65808UniRef Annotation by Michelle Graham. Most informative UniRef hit: Magnesium chelatase subunit n=1 Tax=Glycine max RepID=O65808_SOYBN SoyBaseE_val: 7.00E-79ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g17941 not represented in the dataset

Glyma20g17941 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g073800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g17941.1   sequence type=CDS   gene model=Glyma20g17941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAATGTGCTGCCATTGGCAATGGCCTATTCACCCAAACCACCCCAGAAGTTCATAGAATTGTTCCAGAGAATGACCACAACTTGCCAATAGTTAAAATTGTGTATGAGGACCTTCAGGCTCAGTACCAATCATCCCTCACTGCTGCAGTGATAGCTTTCAATAGCAAAAGGAAGCATGCTTCCTATGTGGTTCTTGGTTACTTGGTTGAGGAGCTTCGGGACATGGTGATGTACAAGACCTTCTGCAAGGACTTGGAGGATGCCAACATCTTCATTGGGTCCTTGATTTTTGTGGAGGAGCTTGCCCTCAAGATAAAGGCTGCAATGGAGAAAGAAAGGGAAAGGCTTGATGCAGTTTTGGTGTTTCCATCAATGGATGAAGTGATGAGACTCAACAAGTTGGGTTCCTTCAGTATGTCACAGCTTCGACAGTCAAACAACCCCTTTTTCCACCTCATCATCCATTTCTATGTGAAGCAGCAGTATTCTATGTGGTCTTTCATATCTTCGTTGTATGCCCACTAA

>Glyma20g17941.1   sequence type=predicted peptide   gene model=Glyma20g17941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKCAAIGNGLFTQTTPEVHRIVPENDHNLPIVKIVYEDLQAQYQSSLTAAVIAFNSKRKHASYVVLGYLVEELRDMVMYKTFCKDLEDANIFIGSLIFVEELALKIKAAMEKERERLDAVLVFPSMDEVMRLNKLGSFSMSQLRQSNNPFFHLIIHFYVKQQYSMWSFISSLYAH*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo