SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g17921): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g17921): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g17921

Feature Type:gene_model
Chromosome:Gm20
Start:24952096
stop:24952497
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G03770AT Annotation by Michelle Graham. TAIR10: Leucine-rich repeat protein kinase family protein | chr3:945303-948436 REVERSE LENGTH=802 SoyBaseE_val: 3.00E-28ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0007169GO-bp Annotation by Michelle Graham. GO Biological Process: transmembrane receptor protein tyrosine kinase signaling pathway SoyBaseN/AISS
GO:0009718GO-bp Annotation by Michelle Graham. GO Biological Process: anthocyanin-containing compound biosynthetic process SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0010224GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV-B SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF465Panther SUBFAMILY NOT NAMED JGI ISS
PF00560PFAM Leucine Rich Repeat JGI ISS
UniRef100_A5A0Y6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Receptor-like kinase 17 n=1 Tax=Solanum chacoense RepID=A5A0Y6_SOLCH SoyBaseE_val: 2.00E-35ISS
UniRef100_I1MI91UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MI91_SOYBN SoyBaseE_val: 1.00E-62ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g17921 not represented in the dataset

Glyma20g17921 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g073700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g17921.1   sequence type=CDS   gene model=Glyma20g17921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCAACAACCCATGACCTGCCAACTTCATTGAATGCTCTTCATACCTTGAGGGTGTTAGATCTATCAAATAATCAGTTATTTGGGGAACTTCCTCATCTTAAGAATTTGGAAAACCTTCAAGTTCTTAACTTGGAAAACAACACATTTGGACCTCATTTTCCTTCTCTCCCCACCAAGTTGGTTTCCCTTGTGCTTAGAAATAATAGCTTCAAGTTAAGTGTCCCTTTTAATTTAAGTTCTTTCTATCTGCTCCAAAGGCTAGACCTTTCATTGAATGGTTTTGTGGGGCCATTTCCACCATCCTTATTGTCACTACCTTCCATCAATTACCTTGATATTTCCTCAAATAAATTCACTAACAAGATCCATAAAGGAGCATGTCATGAGTCGGGTGAATAG

>Glyma20g17921.1   sequence type=predicted peptide   gene model=Glyma20g17921   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSTTHDLPTSLNALHTLRVLDLSNNQLFGELPHLKNLENLQVLNLENNTFGPHFPSLPTKLVSLVLRNNSFKLSVPFNLSSFYLLQRLDLSLNGFVGPFPPSLLSLPSINYLDISSNKFTNKIHKGACHESGE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo