SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g17900

Feature Type:gene_model
Chromosome:Gm20
Start:24951335
stop:24951621
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g17900
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G22000AT Annotation by Michelle Graham. TAIR10: RING-H2 group F2A | chr5:7277436-7279553 FORWARD LENGTH=375 SoyBaseE_val: 8.00E-28ISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0006914GO-bp Annotation by Michelle Graham. GO Biological Process: autophagy SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0009561GO-bp Annotation by Michelle Graham. GO Biological Process: megagametogenesis SoyBaseN/AISS
GO:0009627GO-bp Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance SoyBaseN/AISS
GO:0009697GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid biosynthetic process SoyBaseN/AISS
GO:0009755GO-bp Annotation by Michelle Graham. GO Biological Process: hormone-mediated signaling pathway SoyBaseN/AISS
GO:0016558GO-bp Annotation by Michelle Graham. GO Biological Process: protein import into peroxisome matrix SoyBaseN/AISS
GO:0044265GO-bp Annotation by Michelle Graham. GO Biological Process: cellular macromolecule catabolic process SoyBaseN/AISS
GO:0051603GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis involved in cellular protein catabolic process SoyBaseN/AISS
GO:0051726GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle SoyBaseN/AISS
GO:0055046GO-bp Annotation by Michelle Graham. GO Biological Process: microgametogenesis SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PF00097PFAM Zinc finger, C3HC4 type (RING finger) JGI ISS
UniRef100_G7IRI2UniRef Annotation by Michelle Graham. Most informative UniRef hit: RING finger protein n=1 Tax=Medicago truncatula RepID=G7IRI2_MEDTR SoyBaseE_val: 1.00E-27ISS
UniRef100_I1M467UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M467_SOYBN SoyBaseE_val: 2.00E-28ISS

Expression Patterns of Glyma20g17900
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g17900 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma20g17900
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g17900
>Glyma20g17900.1   sequence type=CDS   gene model=Glyma20g17900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GAGGCGCATTTGACTTCTACCGCTGCTTTTGTGGAGGGTGGAATTCATGATGCTTGTGATGATGCTTGCAGCATATGCCTTGAAGCTTTCTATGATAGTGATCCCTCCACGGTGACAAGTTGCAAGCATGAGTTTCATATTCAATGCATTATGGAATGGTATTGCTATTTGGCTTCATTAATTGAATTTTTT
Predicted protein sequences of Glyma20g17900
>Glyma20g17900.1   sequence type=predicted peptide   gene model=Glyma20g17900   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
EAHLTSTAAFVEGGIHDACDDACSICLEAFYDSDPSTVTSCKHEFHIQCIMEWYCYLASLIEFF






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo