SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g17586

Feature Type:gene_model
Chromosome:Gm20
Start:24639992
stop:24642792
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g17586
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G19130AT Annotation by Michelle Graham. TAIR10: Replication factor-A protein 1-related | chr4:10466618-10469092 REVERSE LENGTH=784 SoyBaseE_val: 1.00E-31ISS
GO:0006260GO-bp Annotation by Michelle Graham. GO Biological Process: DNA replication SoyBaseN/AISS
GO:0006302GO-bp Annotation by Michelle Graham. GO Biological Process: double-strand break repair SoyBaseN/AISS
GO:0010332GO-bp Annotation by Michelle Graham. GO Biological Process: response to gamma radiation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003677GO-mf Annotation by Michelle Graham. GO Molecular Function: DNA binding SoyBaseN/AISS
GO:0008270GO-mf Annotation by Michelle Graham. GO Molecular Function: zinc ion binding SoyBaseN/AISS
PTHR23273Panther REPLICATION FACTOR A 1, RFA1 JGI ISS
PF08646PFAM Replication factor-A C terminal domain JGI ISS
UniRef100_B9S1L9UniRef Annotation by Michelle Graham. Most informative UniRef hit: Replication factor A 1, rfa1, putative n=1 Tax=Ricinus communis RepID=B9S1L9_RICCO SoyBaseE_val: 2.00E-29ISS
UniRef100_I1MGZ7UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MGZ7_SOYBN SoyBaseE_val: 3.00E-72ISS

Expression Patterns of Glyma20g17586
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g17586 not represented in the dataset
Glyma20g17586 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g17586 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma20g17586
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g17586
>Glyma20g17586.1   sequence type=CDS   gene model=Glyma20g17586   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCTAATCTAGGTAAGACTGATGTGCGGAAGACTATATCTCAAATTAAAGATGAGAAGTTAGGGACTTTAGAGAAGCCTGATTGGATATCTGTCTTTGTAGCTGTTTCACACATTAAGGTTGATAACTTCTGTTACCTCGGGTGCCCTCTCAAGATAAGGGATAGACAATGTAACAAAAAAGTTACTAATAACGCAGATGGGACATGGCATTGTGAAAGATGTAATCAGTCTATTGACACATGTGACTTTAGTTTGAGAGAGGACTTATGCTCAAAGGAAAGGAGTGGAAGCTGTTCTGGACAGACCATAAAAAGGCAAAGGGAGAGATGCAAAATAAGCAGAAACAATGATGATGGTTATGATGAAGACATGGAAGTGGATTTGACTCTAAGCATAGGAGGAGGAAACCAAGTTAATAATAACAAGAATAGTAGTAGTAAGAAACCTTATCTGCTTCCATTAGGGTGCTCAGACTCACCCAATGGGAAAACTAGGGACCTAAATTCTTCTGTCTCTTTCCAATCAGATAGGGTGAGAGATTTCAGTGACCCCACCACCCCTATGAGAAGCTCAAGTGTGACATTTGATCAAGAGAGAAAGGGGCCACATTGGCTTTCTCAAGGTTTAAAGCTTAAATAG
Predicted protein sequences of Glyma20g17586
>Glyma20g17586.1   sequence type=predicted peptide   gene model=Glyma20g17586   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSNLGKTDVRKTISQIKDEKLGTLEKPDWISVFVAVSHIKVDNFCYLGCPLKIRDRQCNKKVTNNADGTWHCERCNQSIDTCDFSLREDLCSKERSGSCSGQTIKRQRERCKISRNNDDGYDEDMEVDLTLSIGGGNQVNNNKNSSSKKPYLLPLGCSDSPNGKTRDLNSSVSFQSDRVRDFSDPTTPMRSSSVTFDQERKGPHWLSQGLKLK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo