|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G03540 | AT | Annotation by Michelle Graham. TAIR10: exocyst subunit exo70 family protein A1 | chr5:890194-893916 FORWARD LENGTH=523 | SoyBase | E_val: 7.00E-47 | ISS |
| GO:0000902 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell morphogenesis | SoyBase | N/A | ISS |
| GO:0000919 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell plate assembly | SoyBase | N/A | ISS |
| GO:0006096 | GO-bp | Annotation by Michelle Graham. GO Biological Process: glycolysis | SoyBase | N/A | ISS |
| GO:0006605 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting | SoyBase | N/A | ISS |
| GO:0006623 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole | SoyBase | N/A | ISS |
| GO:0006833 | GO-bp | Annotation by Michelle Graham. GO Biological Process: water transport | SoyBase | N/A | ISS |
| GO:0006904 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vesicle docking involved in exocytosis | SoyBase | N/A | ISS |
| GO:0006972 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hyperosmotic response | SoyBase | N/A | ISS |
| GO:0007030 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi organization | SoyBase | N/A | ISS |
| GO:0009266 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0010102 | GO-bp | Annotation by Michelle Graham. GO Biological Process: lateral root morphogenesis | SoyBase | N/A | ISS |
| GO:0016049 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell growth | SoyBase | N/A | ISS |
| GO:0032502 | GO-bp | Annotation by Michelle Graham. GO Biological Process: developmental process | SoyBase | N/A | ISS |
| GO:0042814 | GO-bp | Annotation by Michelle Graham. GO Biological Process: monopolar cell growth | SoyBase | N/A | ISS |
| GO:0046686 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cadmium ion | SoyBase | N/A | ISS |
| GO:0048193 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport | SoyBase | N/A | ISS |
| GO:0048354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: mucilage biosynthetic process involved in seed coat development | SoyBase | N/A | ISS |
| GO:0048364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root development | SoyBase | N/A | ISS |
| GO:0048767 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair elongation | SoyBase | N/A | ISS |
| GO:0060918 | GO-bp | Annotation by Michelle Graham. GO Biological Process: auxin transport | SoyBase | N/A | ISS |
| GO:1901703 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein localization involved in auxin polar transport | SoyBase | N/A | ISS |
| GO:0000145 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: exocyst | SoyBase | N/A | ISS |
| GO:0005634 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleus | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009504 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cell plate | SoyBase | N/A | ISS |
| GO:0009506 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0070062 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular vesicular exosome | SoyBase | N/A | ISS |
| GO:0090404 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: pollen tube tip | SoyBase | N/A | ISS |
| GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
| PTHR12542 | Panther | EXOCYST COMPLEX PROTEIN EXO70-RELATED | JGI | ISS | |
| PTHR12542:SF7 | Panther | EXOCYST COMPLEX PROTEIN EXO70 | JGI | ISS | |
| PF03081 | PFAM | Exo70 exocyst complex subunit | JGI | ISS | |
| UniRef100_G7I413 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Exocyst complex component EXO70 n=1 Tax=Medicago truncatula RepID=G7I413_MEDTR | SoyBase | E_val: 5.00E-52 | ISS |
| UniRef100_UPI000233D991 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233D991 related cluster n=1 Tax=unknown RepID=UPI000233D991 | SoyBase | E_val: 1.00E-80 | ISS |
|
Glyma20g17545 not represented in the dataset |
Glyma20g17545 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.20g072900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g17545.1 sequence type=CDS gene model=Glyma20g17545 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTCACCCCATCCTCCATTGATTCTTCAGTCCCTCTCTATTCAGGGCCTCATCTCATCAAGTGGTGGTGGTGGTGGTAGTACTGCTAGTGGCGATGCAGGGAGTAGTGGTGCTTCAAGAGCAATTGTTAAAGACAGGTTTAAGACATTCAATACTATGTTTGAGGAACTTCATCAGAAACAATCTCAGTGGACAGTACCAGACACAGAGTTGCGTGAGTCTCTTATTCTTGCAGTTGCTGAAGTCTTGCTGCCTGCCTACAGATCATTTGTGAAACGTTTTGGGCCACTAGTGGAGAATGTAAAGAGTACTCAGAGGTACGTCAAATACACTGCTGAAGATCTAGAGCGAATCTTAGGTGAGTTTTTTGAAGGAAAAAACATGAATGATAATAAGCGGTAA
>Glyma20g17545.1 sequence type=predicted peptide gene model=Glyma20g17545 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MSPHPPLILQSLSIQGLISSSGGGGGSTASGDAGSSGASRAIVKDRFKTFNTMFEELHQKQSQWTVPDTELRESLILAVAEVLLPAYRSFVKRFGPLVENVKSTQRYVKYTAEDLERILGEFFEGKNMNDNKR*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||