SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g17545

Feature Type:gene_model
Chromosome:Gm20
Start:24579701
stop:24581897
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g17545
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G03540AT Annotation by Michelle Graham. TAIR10: exocyst subunit exo70 family protein A1 | chr5:890194-893916 FORWARD LENGTH=523 SoyBaseE_val: 7.00E-47ISS
GO:0000902GO-bp Annotation by Michelle Graham. GO Biological Process: cell morphogenesis SoyBaseN/AISS
GO:0000919GO-bp Annotation by Michelle Graham. GO Biological Process: cell plate assembly SoyBaseN/AISS
GO:0006096GO-bp Annotation by Michelle Graham. GO Biological Process: glycolysis SoyBaseN/AISS
GO:0006605GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0006833GO-bp Annotation by Michelle Graham. GO Biological Process: water transport SoyBaseN/AISS
GO:0006904GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle docking involved in exocytosis SoyBaseN/AISS
GO:0006972GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic response SoyBaseN/AISS
GO:0007030GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi organization SoyBaseN/AISS
GO:0009266GO-bp Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus SoyBaseN/AISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0010102GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root morphogenesis SoyBaseN/AISS
GO:0016049GO-bp Annotation by Michelle Graham. GO Biological Process: cell growth SoyBaseN/AISS
GO:0032502GO-bp Annotation by Michelle Graham. GO Biological Process: developmental process SoyBaseN/AISS
GO:0042814GO-bp Annotation by Michelle Graham. GO Biological Process: monopolar cell growth SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0048193GO-bp Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport SoyBaseN/AISS
GO:0048354GO-bp Annotation by Michelle Graham. GO Biological Process: mucilage biosynthetic process involved in seed coat development SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0048767GO-bp Annotation by Michelle Graham. GO Biological Process: root hair elongation SoyBaseN/AISS
GO:0060918GO-bp Annotation by Michelle Graham. GO Biological Process: auxin transport SoyBaseN/AISS
GO:1901703GO-bp Annotation by Michelle Graham. GO Biological Process: protein localization involved in auxin polar transport SoyBaseN/AISS
GO:0000145GO-cc Annotation by Michelle Graham. GO Cellular Compartment: exocyst SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009504GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell plate SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0070062GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular vesicular exosome SoyBaseN/AISS
GO:0090404GO-cc Annotation by Michelle Graham. GO Cellular Compartment: pollen tube tip SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR12542Panther EXOCYST COMPLEX PROTEIN EXO70-RELATED JGI ISS
PTHR12542:SF7Panther EXOCYST COMPLEX PROTEIN EXO70 JGI ISS
PF03081PFAM Exo70 exocyst complex subunit JGI ISS
UniRef100_G7I413UniRef Annotation by Michelle Graham. Most informative UniRef hit: Exocyst complex component EXO70 n=1 Tax=Medicago truncatula RepID=G7I413_MEDTR SoyBaseE_val: 5.00E-52ISS
UniRef100_UPI000233D991UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D991 related cluster n=1 Tax=unknown RepID=UPI000233D991 SoyBaseE_val: 1.00E-80ISS

Expression Patterns of Glyma20g17545
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g17545 not represented in the dataset
Glyma20g17545 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g17545 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g072900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g17545
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g17545
>Glyma20g17545.1   sequence type=CDS   gene model=Glyma20g17545   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCACCCCATCCTCCATTGATTCTTCAGTCCCTCTCTATTCAGGGCCTCATCTCATCAAGTGGTGGTGGTGGTGGTAGTACTGCTAGTGGCGATGCAGGGAGTAGTGGTGCTTCAAGAGCAATTGTTAAAGACAGGTTTAAGACATTCAATACTATGTTTGAGGAACTTCATCAGAAACAATCTCAGTGGACAGTACCAGACACAGAGTTGCGTGAGTCTCTTATTCTTGCAGTTGCTGAAGTCTTGCTGCCTGCCTACAGATCATTTGTGAAACGTTTTGGGCCACTAGTGGAGAATGTAAAGAGTACTCAGAGGTACGTCAAATACACTGCTGAAGATCTAGAGCGAATCTTAGGTGAGTTTTTTGAAGGAAAAAACATGAATGATAATAAGCGGTAA
Predicted protein sequences of Glyma20g17545
>Glyma20g17545.1   sequence type=predicted peptide   gene model=Glyma20g17545   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSPHPPLILQSLSIQGLISSSGGGGGSTASGDAGSSGASRAIVKDRFKTFNTMFEELHQKQSQWTVPDTELRESLILAVAEVLLPAYRSFVKRFGPLVENVKSTQRYVKYTAEDLERILGEFFEGKNMNDNKR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo