|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT4G28950 | AT | Annotation by Michelle Graham. TAIR10: RHO-related protein from plants 9 | chr4:14278289-14279705 FORWARD LENGTH=209 | SoyBase | E_val: 3.00E-47 | ISS |
GO:0006184 | GO-bp | Annotation by Michelle Graham. GO Biological Process: GTP catabolic process | SoyBase | N/A | ISS |
GO:0007015 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin filament organization | SoyBase | N/A | ISS |
GO:0007165 | GO-bp | Annotation by Michelle Graham. GO Biological Process: signal transduction | SoyBase | N/A | ISS |
GO:0007264 | GO-bp | Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction | SoyBase | N/A | ISS |
GO:0015031 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein transport | SoyBase | N/A | ISS |
GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
GO:0005622 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: intracellular | SoyBase | N/A | ISS |
GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
GO:0003924 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: GTPase activity | SoyBase | N/A | ISS |
GO:0005525 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: GTP binding | SoyBase | N/A | ISS |
PTHR24072 | Panther | FAMILY NOT NAMED | JGI | ISS | |
PTHR24072:SF352 | Panther | JGI | ISS | ||
PF00071 | PFAM | Ras family | JGI | ISS | |
UniRef100_A7UQU4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: ROP-like protein n=1 Tax=Medicago truncatula RepID=A7UQU4_MEDTR | SoyBase | E_val: 2.00E-50 | ISS |
UniRef100_I3SR86 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Lotus japonicus RepID=I3SR86_LOTJA | SoyBase | E_val: 4.00E-55 | ISS |
Glyma20g17426 not represented in the dataset |
Glyma20g17426 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.20g072300 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g17426.1 sequence type=CDS gene model=Glyma20g17426 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCCTGTGAACTGCGATTTCTCCAAATTTCCCAAAGGTCTTGCCTGCCAATTAACCCAATTCCAACAAGGGATGCCGGAATTGCGTAGATTTGCACCTAATGTTCCAATTGTTCTTGTTGGTACGAAGTTAGACCGGGGTTATGTAGCTGATCACATGGGATCTAATGTCATAACATCTGCTGAGGGGGAAGAAATGAGGAAACAAATTGGTGCAGCTGCTTACATTGAGTGCAGTTCAAAGAATCAACAGAATGTCAAAGCAGTGTTTGACACTGCAATTAAGGTTGTTCTGGAACCTCCAAGGAGGAAACAAATGGCATGGAAGAAAAGTCATAGAAGGTCTGGTTGCTCATTTGTGTAA
>Glyma20g17426.1 sequence type=predicted peptide gene model=Glyma20g17426 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MPVNCDFSKFPKGLACQLTQFQQGMPELRRFAPNVPIVLVGTKLDRGYVADHMGSNVITSAEGEEMRKQIGAAAYIECSSKNQQNVKAVFDTAIKVVLEPPRRKQMAWKKSHRRSGCSFV*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||