Glyma20g17370 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g17370

Feature Type:	gene_model
Chromosome:	Gm20
Start:	24405876
stop:	24407402
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g17370

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G32180	AT	Annotation by Michelle Graham. TAIR10: pantothenate kinase 2 \| chr4:15538340-15543715 REVERSE LENGTH=783	SoyBase	E_val: 1.00E-44	ISS
GO:0006487	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein N-linked glycosylation	SoyBase	N/A	ISS
GO:0015937	GO-bp	Annotation by Michelle Graham. GO Biological Process: coenzyme A biosynthetic process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0004594	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pantothenate kinase activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
PF01937	PFAM	Protein of unknown function DUF89	JGI		ISS
UniRef100_B9RB16	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Pantothenate kinase, putative n=1 Tax=Ricinus communis RepID=B9RB16_RICCO	SoyBase	E_val: 2.00E-44	ISS
UniRef100_I1MTH1	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTH1_SOYBN	SoyBase	E_val: 2.00E-48	ISS

Expression Patterns of Glyma20g17370

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g17370 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma20g17370

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g17370

Limit To All Plant Sequences

>Glyma20g17370.1   sequence type=CDS   gene model=Glyma20g17370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCATCTCTAGACAATTATTATCCTCAGAATGTCCTTATTCTTGATCACTTCAATTTGTTATTTGTGTTTATATCTATCATAGGGAAAATGAGGCATCACTTGCTATTCTACCTGATTTGTAGATGGAGCTTGATAGAAACAACACTACTTACTCTCATTGAAGGTGTTCTTGTTGCAAACATTTTTTATTGGGGATCTCGTGCATGTGTGGATCTCTATCATATAGGAACTATTATTGAAATTTACAGAATTAGTCGCAACAAAATGCAGAGACCTTGGCGAGTGGATGATTTTGATGCCTTTAAACAAAGAATGTTAGGAACTGGGGACAAGAAACCACCCCCACATAGAAGAGCTTTACTTTTTGTGGACAATGCTGGTGCTGACACAATTTGGATTTTGTTACATTTCAAATACTGGTTGATAATGATTTATCATTATCTTGCTTATTTATATAATATTAAATTAAAAAAAAAAATCTACGTCGGTGCTTACGACAGCAACGACGTAGTTGGCCATGCATTCAACGGCGATCGTTGTCGGTGCAACAATGTAGTAAAG

Predicted protein sequences of Glyma20g17370

Limit To All Plant Sequences

>Glyma20g17370.1   sequence type=predicted peptide   gene model=Glyma20g17370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSLDNYYPQNVLILDHFNLLFVFISIIGKMRHHLLFYLICRWSLIETTLLTLIEGVLVANIFYWGSRACVDLYHIGTIIEIYRISRNKMQRPWRVDDFDAFKQRMLGTGDKKPPPHRRALLFVDNAGADTIWILLHFKYWLIMIYHYLAYLYNIKLKKKIYVGAYDSNDVVGHAFNGDRCRCNNVVK

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain