SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g17246

Feature Type:gene_model
Chromosome:Gm20
Start:24331250
stop:24334796
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g17246
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G14000AT Annotation by Michelle Graham. TAIR10: Putative methyltransferase family protein | chr4:8090851-8092347 FORWARD LENGTH=290 SoyBaseE_val: 7.00E-27ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PTHR21095Panther UNCHARACTERIZED JGI ISS
UniRef100_F4PJU1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptidase M20 family protein n=1 Tax=Dictyostelium fasciculatum (strain SH3) (Slime mold) RepID=F4PJU1_DICFS SoyBaseE_val: 3.00E-10ISS
UniRef100_I1NEE4UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NEE4_SOYBN SoyBaseE_val: 1.00E-77ISS

Expression Patterns of Glyma20g17246
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g17246 not represented in the dataset
Glyma20g17246 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g17246 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g071500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g17246
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g17246
>Glyma20g17246.1   sequence type=CDS   gene model=Glyma20g17246   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTACAATGGAGGAAGGAGTTTGGTGCTAATACTATTATGCAGGGCAATGGTCAGAAATCGAGTTTGGAAACATTTCAGTTATTCTCTTCCTTGGTTTCCGCCTTTGGAATCTTCGATGATGTTGCACAACAAGTTCCTCATATACCTCCTCCTCCCTGCGTTGAAGTCCTTGCATCTGAGGTTCCTTCATACATCAAACACAATGTGGACTCTGTAAATTTGGATGGAGTTACTTTGTTAAAGGGGTGGGTGAATACCAAACAAGTGTTTGGTTTGCCCAACTCCAATTTAGTTCCCGGGAAATATGAAGGAGGACTTAAGTTGTGGGAAGGTTCACTAGATCTAATTAAAGCCCTTCATTCAGATATCAAAAATGGGCTTATCTCATTTAGTGGGAAATGCAAAAAAAATCAAGGTGATGGTTATGAATTTATTGTTATGGCAGAGACAGTTTACTCAATCAACAGACTCCAAAATCTCTATGATCTTATCAAGAAGTGCTTGCAGCATCCTGATGGAGTTGTGTACATGGCAGCAAAGAAGTATTATTTTGGTGTAGGTGGTGGAACTCAACGATTTCTGTCTATGGTAGAGAAGGATGATATACCCTTTACTTGTGCCACAAAGGATGTATCCTCCAATAAAAACAAGGTTTGGAAAAATGAAACTTAG
Predicted protein sequences of Glyma20g17246
>Glyma20g17246.1   sequence type=predicted peptide   gene model=Glyma20g17246   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLQWRKEFGANTIMQGNGQKSSLETFQLFSSLVSAFGIFDDVAQQVPHIPPPPCVEVLASEVPSYIKHNVDSVNLDGVTLLKGWVNTKQVFGLPNSNLVPGKYEGGLKLWEGSLDLIKALHSDIKNGLISFSGKCKKNQGDGYEFIVMAETVYSINRLQNLYDLIKKCLQHPDGVVYMAAKKYYFGVGGGTQRFLSMVEKDDIPFTCATKDVSSNKNKVWKNET*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo