Report for Sequence Feature Glyma20g16910
Feature Type: gene_model
Chromosome: Gm20
Start: 23746055
stop: 23747474
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma20g16910
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G51190 AT
Annotation by Michelle Graham. TAIR10: Integrase-type DNA-binding superfamily protein | chr5:20800708-20801373 REVERSE LENGTH=221
SoyBase E_val: 3.00E-55 ISS
GO:0002679 GO-bp
Annotation by Michelle Graham. GO Biological Process: respiratory burst involved in defense response
SoyBase N/A ISS
GO:0006355 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent
SoyBase N/A ISS
GO:0009611 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to wounding
SoyBase N/A ISS
GO:0009612 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to mechanical stimulus
SoyBase N/A ISS
GO:0010200 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to chitin
SoyBase N/A ISS
GO:0035556 GO-bp
Annotation by Michelle Graham. GO Biological Process: intracellular signal transduction
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0003677 GO-mf
Annotation by Michelle Graham. GO Molecular Function: DNA binding
SoyBase N/A ISS
GO:0003700 GO-mf
Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity
SoyBase N/A ISS
PF00847 PFAM
AP2 domain
JGI ISS
UniRef100_I1NEC8 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=2 Tax=Glycine max RepID=I1NEC8_SOYBN
SoyBase E_val: 0 ISS
UniRef100_I7DM20 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Ethylene-responsive factor 1 n=1 Tax=Cicer arietinum RepID=I7DM20_CICAR
SoyBase E_val: 2.00E-84 ISS
Expression Patterns of Glyma20g16910
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma20g16910
Paralog Evidence Comments
Glyma10g23440 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma20g16910 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.20g070000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma20g16910
Coding sequences of Glyma20g16910
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma20g16910.1 sequence type=CDS gene model=Glyma20g16910 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGCAAAGTTCAATCTCACAATCTGAGATTTGCATCACTGATTACCTTCTACCCCAAGAAGTTCCATCTCAATTTCAATTTCCAGATATGAGCAACAATAACATACCAATGAACCATACCAACCTTCAAATGCCTCAAATCACATCTTTCTCCAAGCCTCCAAGGTCCTCATCAAATCTAAGCAACCGCAAACCGTCCTTGAGAAACATCACAATCCCTTCCATAACCTCAGGTCTTACAACAACTATGTCACAAACAACAACAACAACAACAATAGCTACAACCATGTATAACAACAATCAAGTTACTTCTTCTTCAGATGAAACCAACAACATCAAAGAGAACAAGCACTATAGAGGGGTTAGAAGAAGGCCATGGGGCAAGTATGCTGCAGAAATCCGTGACCCTAATAGAAAAGGCTCAAGGGTGTGGCTTGGAACCTTTGACACAGCCATAGAAGCTGCCAAGGCTTATGACAAAGCTGCTTTCAAGATGAGAGGGAGCAAAGCCATATTGAATTTCCCTTTGGAGATTGGAGAGTCAGAGGAATCAGTCTCAAGCTGCATCAAGGTTGGTGTGAAGAGGGAAAGAGAGGAAGAGAGTAAAAGCAACAACTATGAGAAAAGTGAGTTTAACAACAATAATAATAGTAATAAGCATGTGAAGAAAGAAGAGTGTTCTCCCAAAGCTGTTTGCCCTTTGACTCCATCATGTTGGAAAGGCTTTTGGGACACTGATGTTATGGGAACTATCTTTAGTGTGCCTCCTTTGTCACCACTATCTCCACTAATGGTTGTTTGA
Predicted protein sequences of Glyma20g16910
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma20g16910.1 sequence type=predicted peptide gene model=Glyma20g16910 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MQSSISQSEICITDYLLPQEVPSQFQFPDMSNNNIPMNHTNLQMPQITSFSKPPRSSSNLSNRKPSLRNITIPSITSGLTTTMSQTTTTTTIATTMYNNNQVTSSSDETNNIKENKHYRGVRRRPWGKYAAEIRDPNRKGSRVWLGTFDTAIEAAKAYDKAAFKMRGSKAILNFPLEIGESEESVSSCIKVGVKREREEESKSNNYEKSEFNNNNNSNKHVKKEECSPKAVCPLTPSCWKGFWDTDVMGTIFSVPPLSPLSPLMVV*