Glyma20g16680 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g16680

Feature Type:	gene_model
Chromosome:	Gm20
Start:	23352998
stop:	23354095
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g16680

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
UniRef100_G7ZVA4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Replication protein A1-like protein n=1 Tax=Medicago truncatula RepID=G7ZVA4_MEDTR	SoyBase	E_val: 1.00E-07	ISS
UniRef100_UPI000233DCC9	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DCC9 related cluster n=1 Tax=unknown RepID=UPI000233DCC9	SoyBase	E_val: 9.00E-60	ISS

Expression Patterns of Glyma20g16680

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g16680 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma20g16680

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g16680

Limit To All Plant Sequences

>Glyma20g16680.1   sequence type=CDS   gene model=Glyma20g16680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTAACATTAGCTAAGATCAAAGATGCCAAAGACAAGTATCCGCTGAGTGTCCAAAATATAAAGAATGGTTCCAAGTTGTATGTGAACGCCGATATTGCCAAGATCAAGAAATTCCGTAATGCTTTACGTGTGTCATTTTATGTTGGCGGAGCAACAGATGAAGGGAGTGGTTCTCAGTCCCAGTATACCAACAATTCACAAAGAATGCTGCAGGATAAGTTCTTGCATAATGCTCAGATGGTGAGCTTAGGTGACATAAGCAAACTGAGAGAGGTAAGAACAACAAATTTTAAATGA

Predicted protein sequences of Glyma20g16680

Limit To All Plant Sequences

>Glyma20g16680.1   sequence type=predicted peptide   gene model=Glyma20g16680   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLTLAKIKDAKDKYPLSVQNIKNGSKLYVNADIAKIKKFRNALRVSFYVGGATDEGSGSQSQYTNNSQRMLQDKFLHNAQMVSLGDISKLREVRTTNFK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain