Glyma20g16660 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g16660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g16660): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g16660

Feature Type:	gene_model
Chromosome:	Gm20
Start:	23341457
stop:	23348539
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g16660

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G55810	AT	Annotation by Michelle Graham. TAIR10: uridine kinase-like 3 \| chr1:20861273-20864003 FORWARD LENGTH=461	SoyBase	E_val: 1.00E-62	ISS
GO:0006094	GO-bp	Annotation by Michelle Graham. GO Biological Process: gluconeogenesis	SoyBase	N/A	ISS
GO:0007010	GO-bp	Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization	SoyBase	N/A	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0009058	GO-bp	Annotation by Michelle Graham. GO Biological Process: biosynthetic process	SoyBase	N/A	ISS
GO:0010498	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process	SoyBase	N/A	ISS
GO:0005575	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cellular component	SoyBase	N/A	ISS
GO:0004845	GO-mf	Annotation by Michelle Graham. GO Molecular Function: uracil phosphoribosyltransferase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
GO:0016773	GO-mf	Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, alcohol group as acceptor	SoyBase	N/A	ISS
PTHR10285	Panther	URIDINE KINASE RELATED	JGI		ISS
UniRef100_I1KYV2	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uridine kinase n=1 Tax=Glycine max RepID=I1KYV2_SOYBN	SoyBase	E_val: 5.00E-64	ISS
UniRef100_I1KYV2	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Uridine kinase n=1 Tax=Glycine max RepID=I1KYV2_SOYBN	SoyBase	E_val: 5.00E-64	ISS

Expression Patterns of Glyma20g16660

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g16660 not represented in the dataset	Glyma20g16660 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g16660 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma20g16660

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g16660

Limit To All Plant Sequences

>Glyma20g16660.1   sequence type=CDS   gene model=Glyma20g16660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTAATTTCAGTGGGGGAGAGTATGGAGAATGCTTTGAGAGCATGCTGTAAAGGTATAAAGATTGGGAAAATTTTAATTCACAGAGAAGGTGACAATGGTCAGCAGTTGCCAAATGATATCTCAGATAGGCATGTGTTAGTGTTGGACCCTGTACTTGCACAGAAATTGATTCTTGGTTTTGCTGATGAAAAGGGTGTACCTAAGTCCAACATTATATTCCTTAATCTGATATCCGCAGCTAAAGGTGTGCATGTGGTATGCAAAAGTTTTCCAAGAATAAAGATAGTGACATCCGAGATTGAGATTGGTTTGAATGAAGATTTCCGTGTCATACCTGGCATGGGCGAGTTTGGAGATCGGTACTTTGGAACAAATGATGAT

Predicted protein sequences of Glyma20g16660

Limit To All Plant Sequences

>Glyma20g16660.1   sequence type=predicted peptide   gene model=Glyma20g16660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LISVGESMENALRACCKGIKIGKILIHREGDNGQQLPNDISDRHVLVLDPVLAQKLILGFADEKGVPKSNIIFLNLISAAKGVHVVCKSFPRIKIVTSEIEIGLNEDFRVIPGMGEFGDRYFGTNDD

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain