SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g16660

Feature Type:gene_model
Chromosome:Gm20
Start:23341457
stop:23348539
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g16660
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G55810AT Annotation by Michelle Graham. TAIR10: uridine kinase-like 3 | chr1:20861273-20864003 FORWARD LENGTH=461 SoyBaseE_val: 1.00E-62ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009058GO-bp Annotation by Michelle Graham. GO Biological Process: biosynthetic process SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0005575GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cellular component SoyBaseN/AISS
GO:0004845GO-mf Annotation by Michelle Graham. GO Molecular Function: uracil phosphoribosyltransferase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016773GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, alcohol group as acceptor SoyBaseN/AISS
PTHR10285Panther URIDINE KINASE RELATED JGI ISS
UniRef100_I1KYV2UniRef Annotation by Michelle Graham. Best UniRef hit: Uridine kinase n=1 Tax=Glycine max RepID=I1KYV2_SOYBN SoyBaseE_val: 5.00E-64ISS
UniRef100_I1KYV2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Uridine kinase n=1 Tax=Glycine max RepID=I1KYV2_SOYBN SoyBaseE_val: 5.00E-64ISS

Expression Patterns of Glyma20g16660
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g16660 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma20g16660
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g16660
>Glyma20g16660.1   sequence type=CDS   gene model=Glyma20g16660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTAATTTCAGTGGGGGAGAGTATGGAGAATGCTTTGAGAGCATGCTGTAAAGGTATAAAGATTGGGAAAATTTTAATTCACAGAGAAGGTGACAATGGTCAGCAGTTGCCAAATGATATCTCAGATAGGCATGTGTTAGTGTTGGACCCTGTACTTGCACAGAAATTGATTCTTGGTTTTGCTGATGAAAAGGGTGTACCTAAGTCCAACATTATATTCCTTAATCTGATATCCGCAGCTAAAGGTGTGCATGTGGTATGCAAAAGTTTTCCAAGAATAAAGATAGTGACATCCGAGATTGAGATTGGTTTGAATGAAGATTTCCGTGTCATACCTGGCATGGGCGAGTTTGGAGATCGGTACTTTGGAACAAATGATGAT
Predicted protein sequences of Glyma20g16660
>Glyma20g16660.1   sequence type=predicted peptide   gene model=Glyma20g16660   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LISVGESMENALRACCKGIKIGKILIHREGDNGQQLPNDISDRHVLVLDPVLAQKLILGFADEKGVPKSNIIFLNLISAAKGVHVVCKSFPRIKIVTSEIEIGLNEDFRVIPGMGEFGDRYFGTNDD






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo