SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g16611

Feature Type:gene_model
Chromosome:Gm20
Start:23239761
stop:23243423
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g16611
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G72020AT Annotation by Michelle Graham. TAIR10: unknown protein; Has 52 Blast hits to 52 proteins in 18 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 52; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:27109521-27110327 REVERSE LENGTH=97 SoyBaseE_val: 2.00E-43ISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009853GO-bp Annotation by Michelle Graham. GO Biological Process: photorespiration SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_A5X2S6UniRef Annotation by Michelle Graham. Most informative UniRef hit: SLL1 protein n=1 Tax=Primula vulgaris RepID=A5X2S6_9ERIC SoyBaseE_val: 1.00E-35ISS
UniRef100_C6T170UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T170_SOYBN SoyBaseE_val: 4.00E-63ISS

Expression Patterns of Glyma20g16611
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g16611 not represented in the dataset
Glyma20g16611 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g16611 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g068500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g16611
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g16611
>Glyma20g16611.1   sequence type=CDS   gene model=Glyma20g16611   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTTCAACAACGCACTGAGATCTGCCGCGAAGCTCGTCGCTTCTTCCGAATCTTCCTTCTCTAACTCAGTGAGCAGAGGTTTTCATTCAACTGGCATGAAGAGGATGGGAGGTGGACATGGTCATGATGAGCCCTACTATCTTCATGCAAAGCACATGTACAACTTGGACAAGATGAAGCACCAGGGGTTGAAAATGTCCCTTGCTGTGTTCACTGCTTTCAGCATTGGTGTTGCAGTTCCTGTGTATGCTGTCATTTTCCAGCAAAAGAAAACAGCTTCTGCCTAG
Predicted protein sequences of Glyma20g16611
>Glyma20g16611.1   sequence type=predicted peptide   gene model=Glyma20g16611   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAFNNALRSAAKLVASSESSFSNSVSRGFHSTGMKRMGGGHGHDEPYYLHAKHMYNLDKMKHQGLKMSLAVFTAFSIGVAVPVYAVIFQQKKTASA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo