|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G72020 | AT | Annotation by Michelle Graham. TAIR10: unknown protein; Has 52 Blast hits to 52 proteins in 18 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 52; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr1:27109521-27110327 REVERSE LENGTH=97 | SoyBase | E_val: 2.00E-43 | ISS |
| GO:0006511 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process | SoyBase | N/A | ISS |
| GO:0008150 | GO-bp | Annotation by Michelle Graham. GO Biological Process: biological process | SoyBase | N/A | ISS |
| GO:0009853 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photorespiration | SoyBase | N/A | ISS |
| GO:0051788 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to misfolded protein | SoyBase | N/A | ISS |
| GO:0080129 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly | SoyBase | N/A | ISS |
| GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
| UniRef100_A5X2S6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: SLL1 protein n=1 Tax=Primula vulgaris RepID=A5X2S6_9ERIC | SoyBase | E_val: 1.00E-35 | ISS |
| UniRef100_C6T170 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6T170_SOYBN | SoyBase | E_val: 4.00E-63 | ISS |
|
Glyma20g16611 not represented in the dataset |
Glyma20g16611 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.20g068500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g16611.1 sequence type=CDS gene model=Glyma20g16611 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCCTTCAACAACGCACTGAGATCTGCCGCGAAGCTCGTCGCTTCTTCCGAATCTTCCTTCTCTAACTCAGTGAGCAGAGGTTTTCATTCAACTGGCATGAAGAGGATGGGAGGTGGACATGGTCATGATGAGCCCTACTATCTTCATGCAAAGCACATGTACAACTTGGACAAGATGAAGCACCAGGGGTTGAAAATGTCCCTTGCTGTGTTCACTGCTTTCAGCATTGGTGTTGCAGTTCCTGTGTATGCTGTCATTTTCCAGCAAAAGAAAACAGCTTCTGCCTAG
>Glyma20g16611.1 sequence type=predicted peptide gene model=Glyma20g16611 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAFNNALRSAAKLVASSESSFSNSVSRGFHSTGMKRMGGGHGHDEPYYLHAKHMYNLDKMKHQGLKMSLAVFTAFSIGVAVPVYAVIFQQKKTASA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||