Report for Sequence Feature Glyma20g16531
Feature Type: gene_model
Chromosome: Gm20
Start: 23066559
stop: 23067667
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma20g16531
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
UniRef100_UPI000233D943 UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233D943 related cluster n=1 Tax=unknown RepID=UPI000233D943
SoyBase E_val: 2.00E-67 ISS
Expression Patterns of Glyma20g16531
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma20g16531
Paralog Evidence Comments
Glyma13g10441 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma20g16531 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.20g068000 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma20g16531
Coding sequences of Glyma20g16531
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma20g16531.1 sequence type=CDS gene model=Glyma20g16531 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTGTTGGTCATCGCACTCACTGTTAGAGTTAGAGTTAGAGTTAGAGTTGGATGGAGTCGTTAACGTTGTGAAGCATAAGCAACAACACAACATGAGATTGAAGAGGAACAAGTTGGAGGACATTCCGGAGGAAACAGAACTTCCTCCTATTGGTATTGATACTAATCCAGCAGAGCTTGAAGAAGCGGGCCTTCACTTGGAAACAGATTTGGAAATACTGAGGCGGGCCATGGATATGGGACTTTGGGCACTCTGCCTCGGTTTCGGCTATATGCTTTCCAGAGCTCACTTTCGTCCACTTTCTTGA
Predicted protein sequences of Glyma20g16531
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma20g16531.1 sequence type=predicted peptide gene model=Glyma20g16531 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MCWSSHSLLELELELELDGVVNVVKHKQQHNMRLKRNKLEDIPEETELPPIGIDTNPAELEEAGLHLETDLEILRRAMDMGLWALCLGFGYMLSRAHFRPLS*