SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g16521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g16521): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g16521

Feature Type:gene_model
Chromosome:Gm20
Start:23050029
stop:23054112
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G11545AT Annotation by Michelle Graham. TAIR10: xyloglucan endotransglucosylase/hydrolase 8 | chr1:3878689-3880286 REVERSE LENGTH=305 SoyBaseE_val: 1.00E-32ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0006073GO-bp Annotation by Michelle Graham. GO Biological Process: cellular glucan metabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0005618GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cell wall SoyBaseN/AISS
GO:0048046GO-cc Annotation by Michelle Graham. GO Cellular Compartment: apoplast SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
GO:0016762GO-mf Annotation by Michelle Graham. GO Molecular Function: xyloglucan:xyloglucosyl transferase activity SoyBaseN/AISS
GO:0016798GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on glycosyl bonds SoyBaseN/AISS
PF00722PFAM Glycosyl hydrolases family 16 JGI ISS
UniRef100_C0IRG0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Xyloglucan endotransglucosylase/hydrolase 1 n=1 Tax=Actinidia eriantha RepID=C0IRG0_ACTER SoyBaseE_val: 1.00E-31ISS
UniRef100_UPI000233E855UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E855 related cluster n=1 Tax=unknown RepID=UPI000233E855 SoyBaseE_val: 7.00E-49ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g16521 not represented in the dataset

Glyma20g16521 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g067800 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g16521.1   sequence type=CDS   gene model=Glyma20g16521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAACAATATCAATGATTATGCAGAATCCCTCTTTCAGATGTGCTCAGAAAATGGTGCGGGGCCAGAAAGAGATGAGCTTGATTTTGAGTTTTTGGGGAACAAAACAGGAGAACCTTATTTGATTCAGACTAATGTTTACAAGAATGGAACTCGTGGGCGTAAGATGAGGCACATGCTTTGGTTTGACCCCACAGAGGACTACCACACCTATTTCATTCAGCAAGAATTAGAATGA

>Glyma20g16521.1   sequence type=predicted peptide   gene model=Glyma20g16521   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MNNINDYAESLFQMCSENGAGPERDELDFEFLGNKTGEPYLIQTNVYKNGTRGRKMRHMLWFDPTEDYHTYFIQQELE*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo