Report for Sequence Feature Glyma20g16490
Feature Type: gene_model
Chromosome: Gm20
Start: 23003584
stop: 23004956
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma20g16490
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G64640 AT
Annotation by Michelle Graham. TAIR10: early nodulin-like protein 8 | chr1:24022482-24023151 REVERSE LENGTH=191
SoyBase E_val: 6.00E-51 ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0031225 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: anchored to membrane
SoyBase N/A ISS
GO:0005507 GO-mf
Annotation by Michelle Graham. GO Molecular Function: copper ion binding
SoyBase N/A ISS
GO:0009055 GO-mf
Annotation by Michelle Graham. GO Molecular Function: electron carrier activity
SoyBase N/A ISS
PF02298 PFAM
Plastocyanin-like domain
JGI ISS
UniRef100_B9RYS5 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Stellacyanin, putative n=1 Tax=Ricinus communis RepID=B9RYS5_RICCO
SoyBase E_val: 2.00E-66 ISS
UniRef100_I1NEB4 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NEB4_SOYBN
SoyBase E_val: 1.00E-138 ISS
Expression Patterns of Glyma20g16490
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma20g16490
Paralog Evidence Comments
Glyma13g10460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma20g16490 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.20g067400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma20g16490
Coding sequences of Glyma20g16490
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma20g16490.1 sequence type=CDS gene model=Glyma20g16490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGACCAATCTTAGAAATCCTAGATTTAACCTCTTTTTGGTGTCTCTCTTGGTTACGTTGGTCCAAATCCAAACCAAGGTGCGGTGCTACCAGTACAAAGTTGGAGATCTAGATTCCTGGGGAATCCCCATTTCACCAAGTTCACAACTATACGACAAATGGTCCAAATACCACTACCTCAGCATTGGTGATTCCCTCCTGTTTCTATACCCACCAAGTCAAGATTCAGTGATTCAAGTAACAGAGGAATCCTACAAGAGCTGCAACCTTAAAGATCCGATTTTGTACATGAACAATGGTAACTCGTTGTTAAACATTACATCAGAGGGTGACTTCTACTTCACCAGTGGAGAGGCTGGTCATTGCCAAAAGAATCAAAAGCTTCATATAACCGTGGGGGTTGGGGGAAACACGAACGCACTTGCTCCAACTTCATTGCCTCTAAACGCACCCTCTTACCCAACTGTATTTGGCAACATTCCCATGGCTCCCTCTACTTCTTCCTCACCTCACCTAACTTCAAAATTTTCCCTCATAATTATTGGATTCTTCCTATGTTATGTGCACTGCTCCCTAGCATAA
Predicted protein sequences of Glyma20g16490
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma20g16490.1 sequence type=predicted peptide gene model=Glyma20g16490 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MTNLRNPRFNLFLVSLLVTLVQIQTKVRCYQYKVGDLDSWGIPISPSSQLYDKWSKYHYLSIGDSLLFLYPPSQDSVIQVTEESYKSCNLKDPILYMNNGNSLLNITSEGDFYFTSGEAGHCQKNQKLHITVGVGGNTNALAPTSLPLNAPSYPTVFGNIPMAPSTSSSPHLTSKFSLIIIGFFLCYVHCSLA*