SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g16463

Feature Type:gene_model
Chromosome:Gm20
Start:22855938
stop:22856838
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g16463
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G05530AT Annotation by Michelle Graham. TAIR10: regulatory particle triple-A ATPase 5A | chr3:1603540-1605993 FORWARD LENGTH=424 SoyBaseE_val: 1.00E-43ISS
GO:0000741GO-bp Annotation by Michelle Graham. GO Biological Process: karyogamy SoyBaseN/AISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006511GO-bp Annotation by Michelle Graham. GO Biological Process: ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0006635GO-bp Annotation by Michelle Graham. GO Biological Process: fatty acid beta-oxidation SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0009553GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac development SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009560GO-bp Annotation by Michelle Graham. GO Biological Process: embryo sac egg cell differentiation SoyBaseN/AISS
GO:0009630GO-bp Annotation by Michelle Graham. GO Biological Process: gravitropism SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0030163GO-bp Annotation by Michelle Graham. GO Biological Process: protein catabolic process SoyBaseN/AISS
GO:0043161GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal ubiquitin-dependent protein catabolic process SoyBaseN/AISS
GO:0043248GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome assembly SoyBaseN/AISS
GO:0051788GO-bp Annotation by Michelle Graham. GO Biological Process: response to misfolded protein SoyBaseN/AISS
GO:0080129GO-bp Annotation by Michelle Graham. GO Biological Process: proteasome core complex assembly SoyBaseN/AISS
GO:0000502GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome complex SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0008540GO-cc Annotation by Michelle Graham. GO Cellular Compartment: proteasome regulatory particle, base subcomplex SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0005516GO-mf Annotation by Michelle Graham. GO Molecular Function: calmodulin binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016787GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity SoyBaseN/AISS
GO:0016887GO-mf Annotation by Michelle Graham. GO Molecular Function: ATPase activity SoyBaseN/AISS
GO:0017111GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity SoyBaseN/AISS
PTHR23073Panther 26S PROTEASE REGULATORY SUBUNIT JGI ISS
PTHR23073:SF7Panther 26S PROTEASE REGULATORY SUBUNIT 6A JGI ISS
PF00004PFAM ATPase family associated with various cellular activities (AAA) JGI ISS
UniRef100_G7I8P7UniRef Annotation by Michelle Graham. Most informative UniRef hit: 26S protease regulatory subunit 6A-like protein n=1 Tax=Medicago truncatula RepID=G7I8P7_MEDTR SoyBaseE_val: 5.00E-41ISS
UniRef100_UPI000233E8B8UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233E8B8 related cluster n=1 Tax=unknown RepID=UPI000233E8B8 SoyBaseE_val: 4.00E-42ISS

Expression Patterns of Glyma20g16463
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g16463 not represented in the dataset
Glyma20g16463 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g16463 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g067100 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g16463
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g16463
>Glyma20g16463.1   sequence type=CDS   gene model=Glyma20g16463   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGGTTGATGAAAAGCCAATGAAGGACTACAATGACATTGGTGGTTTAGAAAAGCAAATACTCTATAAATTGGTTGAAACTATTGTTTTGCCAATGACCCACAAGGAGCGGTTCCAGAAATTTGGAGTTGGTCCACCGGAGGGAGTGCTCTTATATGGACCTCCAGGAACTGGAAAAACACTAATTGCCCATGCTTGTGTAGCACAAGCAAATGCCACTTTTCTGAAGTTGGCAGGTCCACAGCTGGTCCAGACATGA
Predicted protein sequences of Glyma20g16463
>Glyma20g16463.1   sequence type=predicted peptide   gene model=Glyma20g16463   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVDEKPMKDYNDIGGLEKQILYKLVETIVLPMTHKERFQKFGVGPPEGVLLYGPPGTGKTLIAHACVAQANATFLKLAGPQLVQT*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo