Glyma20g16160 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g16160

Feature Type:	gene_model
Chromosome:	Gm20
Start:	22458358
stop:	22460991
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g16160

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT4G10850	AT	Annotation by Michelle Graham. TAIR10: Nodulin MtN3 family protein \| chr4:6675068-6676718 FORWARD LENGTH=258	SoyBase	E_val: 7.00E-95	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0005887	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0051119	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sugar transmembrane transporter activity	SoyBase	N/A	ISS
KOG1623	KOG	Multitransmembrane protein	JGI		ISS
PTHR10791	Panther	STROMAL CELL PROTEIN/NODULIN MTN3-RELATED	JGI		ISS
PF03083	PFAM	MtN3/saliva family	JGI		ISS
UniRef100_A2X3S3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Bidirectional sugar transporter SWEET4 n=2 Tax=Oryza sativa RepID=SWET4_ORYSI	SoyBase	E_val: 4.00E-94	ISS
UniRef100_I1NEA7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NEA7_SOYBN	SoyBase	E_val: 0	ISS

Proteins Associated with Glyma20g16160

Locus	Gene Symbol	Protein Name
	SWEET51	sucrose effluxer gene 51

Expression Patterns of Glyma20g16160

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma20g16160

Paralog	Evidence	Comments
Glyma13g10560	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma20g16160 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g066500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g16160

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g16160

Limit To All Plant Sequences

>Glyma20g16160.1   sequence type=CDS   gene model=Glyma20g16160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTACCGCAGATATTGCGCGAACAGTAGTCGGTATCATAGGAAACATCATCTCGGGCTGCCTCTTCTTGTCTCCCGTGCCAACTTTTGTCCGAATATGGAAGAAAGGATCAGTGGAGCAGTACTCAGCAGTGCCATACCTAGCCACATTGATGAATTGCATGGTATGGACCCTTTATGGCCTCCCCATGGTGCACCCTCACAGCTTGCTGGTGGTGACCATCAACGGTGCAGGGTGTGTCATTGAGATCATCTATGTCACCCTCTTCTTGCTCTACTCCGACCGTACCAAGAGGCTCAAGGTCTTCCTTTGGCTCTTCTTAGAACTCGTCTTCATCGCCGTTCTAACCTTCGTCACATTCACTCTCATCCATTCCGTCAAGAAGCGCTCTGCCGTCGTCGGAACCATTTGCATGCTCTTCAATGTTGCCATGTATGCTTCACCCTTGTCAGTCATGAAACTAGTCATCACGACCAAAAGTGTTGAATACATGCCGTTTTTCCTCTCTCTAGCATCCTTTGGGAATGGCGTGTCTTGGACTACTTATGCTCTCATCCCTTTTGATCCATTCATTGCTATACCAAACGGGATTGGGACAACATTTTCTGTGGCTCAACTAATTCTGTATGCAACCTATTACAAGTCTACGAAGAAGCAAATAGCAGCAAGGAATGCAAAAGAGGTGAATCTCTCAGAGGTGGTTGTTGGTAACAGTACTGTCCAAGATCCCAACAATAACAAGATCAGTGCTGCTCCCAATGGTCTTTAA

Predicted protein sequences of Glyma20g16160

Limit To All Plant Sequences

>Glyma20g16160.1   sequence type=predicted peptide   gene model=Glyma20g16160   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVTADIARTVVGIIGNIISGCLFLSPVPTFVRIWKKGSVEQYSAVPYLATLMNCMVWTLYGLPMVHPHSLLVVTINGAGCVIEIIYVTLFLLYSDRTKRLKVFLWLFLELVFIAVLTFVTFTLIHSVKKRSAVVGTICMLFNVAMYASPLSVMKLVITTKSVEYMPFFLSLASFGNGVSWTTYALIPFDPFIAIPNGIGTTFSVAQLILYATYYKSTKKQIAARNAKEVNLSEVVVGNSTVQDPNNNKISAAPNGL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain