Glyma20g16025 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g16025

Feature Type:	gene_model
Chromosome:	Gm20
Start:	22118474
stop:	22119828
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g16025

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G22275	AT	Annotation by Michelle Graham. TAIR10: unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; Has 22 Blast hits to 22 proteins in 6 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 22; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). \| chr3:7879207-7879754 REVERSE LENGTH=125	SoyBase	E_val: 5.00E-10	ISS
UniRef100_A5AT04	UniRef	Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Vitis vinifera RepID=A5AT04_VITVI	SoyBase	E_val: 9.00E-12	ISS
UniRef100_I3WTA4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Jasmonate ZIM domain protein f n=1 Tax=Nicotiana attenuata RepID=I3WTA4_NICAT	SoyBase	E_val: 1.00E-10	ISS

Expression Patterns of Glyma20g16025

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g16025 not represented in the dataset	Glyma20g16025 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g16025 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g065500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g16025

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g16025

Limit To All Plant Sequences

>Glyma20g16025.1   sequence type=CDS   gene model=Glyma20g16025   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGCGAAACTGCTACTTGGATCTTCGTTTTCGCCCTTCATCTGCTTCATCACCCCATGATTCTATCATGAGCAAAAAAGTTGTTGCCATTCCGCAAAGTAGACGCCACATGCTTGATGTCACAGAACTTCAGGCAAGAGTGATACTATGGTTGGCAAGTCAAGAAAGGGAAGGTAACACAGGACCAGCTTCGGCCACGTCGCTTTCATTGCAATCTCAAGCATTATTAATGCATGCCCCGCAAGGTTCTTCAGTAAAGAGATCCCTAAGGAATTTCCTTCAGAAGAGAAAGAAAAGGTTTCAAAAGTCACACCCCCATTGCTTCTCGCAATAG

Predicted protein sequences of Glyma20g16025

Limit To All Plant Sequences

>Glyma20g16025.1   sequence type=predicted peptide   gene model=Glyma20g16025   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKRNCYLDLRFRPSSASSPHDSIMSKKVVAIPQSRRHMLDVTELQARVILWLASQEREGNTGPASATSLSLQSQALLMHAPQGSSVKRSLRNFLQKRKKRFQKSHPHCFSQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain