SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g15800

Feature Type:gene_model
Chromosome:Gm20
Start:21569219
stop:21569733
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g15800
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G43860AT Annotation by Michelle Graham. TAIR10: glycosyl hydrolase 9A4 | chr3:15707183-15709438 FORWARD LENGTH=486 SoyBaseE_val: 8.00E-40ISS
GO:0005975GO-bp Annotation by Michelle Graham. GO Biological Process: carbohydrate metabolic process SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004553GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds SoyBaseN/AISS
PTHR22298Panther ENDO-1,4-BETA-GLUCANASE JGI ISS
PF00759PFAM Glycosyl hydrolase family 9 JGI ISS
UniRef100_G7J933UniRef Annotation by Michelle Graham. Best UniRef hit: Endoglucanase n=1 Tax=Medicago truncatula RepID=G7J933_MEDTR SoyBaseE_val: 3.00E-56ISS
UniRef100_G7J933UniRef Annotation by Michelle Graham. Most informative UniRef hit: Endoglucanase n=1 Tax=Medicago truncatula RepID=G7J933_MEDTR SoyBaseE_val: 3.00E-56ISS

Expression Patterns of Glyma20g15800
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g15800 not represented in the dataset
Glyma20g15800 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g15800 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma20g15800
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g15800
>Glyma20g15800.1   sequence type=CDS   gene model=Glyma20g15800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTACTAAACAAGTTTGTTGGGCCATCATTGTAGTATGGCTTACATTGCTTGAAGGAAATACAATGCTTGTTAAGGGTGATTTTAATTACAAGGAGGCTCTGACCAAAGGCACAACGTTCAATGAGGCACAATGTACAAGGAAATACAGTGCTAATACAAGGAAGCTCCCTTCAAATAATAGGGTGCCTTGGAGAGGAGACTCAACACTCGATGATGGCAAACTCGCTAATGTGGACCTTGTTGGGGGATACTATGATGCAGGGGACAATGTGAAATATGGGCTCCCCATGGCTTTCACTGTTACTACGCTAGCATGGGGAGCCATTTTTTACAAGTCAGAATTTAAAGCTGCAAATGAGTTAGATAATATTCAAGATGCCATTCTTAAAGCTAGTTCTCGACACAAAAGATGA
Predicted protein sequences of Glyma20g15800
>Glyma20g15800.1   sequence type=predicted peptide   gene model=Glyma20g15800   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGTKQVCWAIIVVWLTLLEGNTMLVKGDFNYKEALTKGTTFNEAQCTRKYSANTRKLPSNNRVPWRGDSTLDDGKLANVDLVGGYYDAGDNVKYGLPMAFTVTTLAWGAIFYKSEFKAANELDNIQDAILKASSRHKR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo