Glyma20g15640 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g15640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g15640): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g15640

Feature Type:	gene_model
Chromosome:	Gm20
Start:	21560353
stop:	21561219
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g15640

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G50340	AT	Annotation by Michelle Graham. TAIR10: ATP-dependent peptidases;nucleotide binding;serine-type endopeptidases;DNA helicases;ATP binding;damaged DNA binding;nucleoside-triphosphatases \| chr5:20491635-20495830 REVERSE LENGTH=587	SoyBase	E_val: 8.00E-28	ISS
GO:0006260	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA replication	SoyBase	N/A	ISS
GO:0006281	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA repair	SoyBase	N/A	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009295	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleoid	SoyBase	N/A	ISS
GO:0000166	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleotide binding	SoyBase	N/A	ISS
GO:0003678	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA helicase activity	SoyBase	N/A	ISS
GO:0003684	GO-mf	Annotation by Michelle Graham. GO Molecular Function: damaged DNA binding	SoyBase	N/A	ISS
GO:0004176	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP-dependent peptidase activity	SoyBase	N/A	ISS
GO:0004252	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0017111	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity	SoyBase	N/A	ISS
UniRef100_G7LGQ6	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DNA repair protein radA-like protein n=1 Tax=Medicago truncatula RepID=G7LGQ6_MEDTR	SoyBase	E_val: 6.00E-36	ISS
UniRef100_I1KV06	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KV06_SOYBN	SoyBase	E_val: 8.00E-38	ISS

Expression Patterns of Glyma20g15640

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g15640 not represented in the dataset	Glyma20g15640 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g15640 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma20g15640

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g15640

Limit To All Plant Sequences

>Glyma20g15640.1   sequence type=CDS   gene model=Glyma20g15640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTAATATGCAGAAAATTACCGAGTGTTGAGCAAATTGGTAACAGAGCAGATCGCCTTAGGATTGAATCAGATATATATTTATATTCAAGTAATGATGTTGAGGACATACTGAAGAAAGTACAATATCTCTCCCCTAGGGCTCTTATTGTTGATTCGATACAAACTGCTTATTTAAAAGGAATAATGGGAAGTCTTGGAGGGATTATGCATGTGAAAGAATGTACTTCAGCTTTACTACGATTTGGGTAG

Predicted protein sequences of Glyma20g15640

Limit To All Plant Sequences

>Glyma20g15640.1   sequence type=predicted peptide   gene model=Glyma20g15640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLICRKLPSVEQIGNRADRLRIESDIYLYSSNDVEDILKKVQYLSPRALIVDSIQTAYLKGIMGSLGGIMHVKECTSALLRFG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain