|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT5G50340 | AT | Annotation by Michelle Graham. TAIR10: ATP-dependent peptidases;nucleotide binding;serine-type endopeptidases;DNA helicases;ATP binding;damaged DNA binding;nucleoside-triphosphatases | chr5:20491635-20495830 REVERSE LENGTH=587 | SoyBase | E_val: 8.00E-28 | ISS |
| GO:0006260 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA replication | SoyBase | N/A | ISS |
| GO:0006281 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA repair | SoyBase | N/A | ISS |
| GO:0006508 | GO-bp | Annotation by Michelle Graham. GO Biological Process: proteolysis | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0009295 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: nucleoid | SoyBase | N/A | ISS |
| GO:0000166 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleotide binding | SoyBase | N/A | ISS |
| GO:0003678 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: DNA helicase activity | SoyBase | N/A | ISS |
| GO:0003684 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: damaged DNA binding | SoyBase | N/A | ISS |
| GO:0004176 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP-dependent peptidase activity | SoyBase | N/A | ISS |
| GO:0004252 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity | SoyBase | N/A | ISS |
| GO:0005524 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATP binding | SoyBase | N/A | ISS |
| GO:0017111 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nucleoside-triphosphatase activity | SoyBase | N/A | ISS |
| UniRef100_G7LGQ6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: DNA repair protein radA-like protein n=1 Tax=Medicago truncatula RepID=G7LGQ6_MEDTR | SoyBase | E_val: 6.00E-36 | ISS |
| UniRef100_I1KV06 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KV06_SOYBN | SoyBase | E_val: 8.00E-38 | ISS |
|
Glyma20g15640 not represented in the dataset |
Glyma20g15640 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g15640.1 sequence type=CDS gene model=Glyma20g15640 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTAATATGCAGAAAATTACCGAGTGTTGAGCAAATTGGTAACAGAGCAGATCGCCTTAGGATTGAATCAGATATATATTTATATTCAAGTAATGATGTTGAGGACATACTGAAGAAAGTACAATATCTCTCCCCTAGGGCTCTTATTGTTGATTCGATACAAACTGCTTATTTAAAAGGAATAATGGGAAGTCTTGGAGGGATTATGCATGTGAAAGAATGTACTTCAGCTTTACTACGATTTGGGTAG
>Glyma20g15640.1 sequence type=predicted peptide gene model=Glyma20g15640 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLICRKLPSVEQIGNRADRLRIESDIYLYSSNDVEDILKKVQYLSPRALIVDSIQTAYLKGIMGSLGGIMHVKECTSALLRFG*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||