Glyma20g15451 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g15451

Feature Type:	gene_model
Chromosome:	Gm20
Start:	21246566
stop:	21256879
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g15451

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G60580	AT	Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein \| chr5:24354298-24356706 FORWARD LENGTH=487	SoyBase	E_val: 2.00E-38	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR23012	Panther	MEMBRANE ASSOCIATED RING FINGER	JGI		ISS
PTHR23012:SF37	Panther	SUBFAMILY NOT NAMED	JGI		ISS
UniRef100_B9S9C1	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein binding protein, putative n=1 Tax=Ricinus communis RepID=B9S9C1_RICCO	SoyBase	E_val: 1.00E-54	ISS
UniRef100_I1LXL7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LXL7_SOYBN	SoyBase	E_val: 6.00E-65	ISS

Expression Patterns of Glyma20g15451

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g15451 not represented in the dataset	Glyma20g15451 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g15451 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma20g15451

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g15451

Limit To All Plant Sequences

>Glyma20g15451.1   sequence type=CDS   gene model=Glyma20g15451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTTGCATACTTTTGTTTTCTTGAGGAGCTACTGGTTTCAGATTTGGGCACTCGTGCACTTGCCATTTCATTACCTTTCTCCTGTGTTTTAGGTCTCCTTTCATCTATGATTGCTTCAACCATGGTGAGCGGGAGTTACATGTGGGCTTATGCTTGCTTCCAGTTTTCAATTGTCATCCTGTTTGCTCATGTGTTTTATACTATACTTAATGTTAATGCCATCCTCTCAGTCCTTCTCTCCTCATTCACTGGATTTGGGATTGCAATCAGCTTGAATACGCTGCTAACAGAGTATGTTAGATGGAAAACAAGAAGACAGATTCAATCTTCTACGGCACGGCAGCAGCGCCGTGATCATGCACTGCAGTAG

Predicted protein sequences of Glyma20g15451

Limit To All Plant Sequences

>Glyma20g15451.1   sequence type=predicted peptide   gene model=Glyma20g15451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLAYFCFLEELLVSDLGTRALAISLPFSCVLGLLSSMIASTMVSGSYMWAYACFQFSIVILFAHVFYTILNVNAILSVLLSSFTGFGIAISLNTLLTEYVRWKTRRQIQSSTARQQRRDHALQ*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain