SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g15230

Feature Type:gene_model
Chromosome:Gm20
Start:20775695
stop:20776396
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g15230
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G22160AT Annotation by Michelle Graham. TAIR10: VQ motif-containing protein | chr3:7818148-7818726 REVERSE LENGTH=192 SoyBaseE_val: 3.00E-13ISS
GO:0006612GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0009414GO-bp Annotation by Michelle Graham. GO Biological Process: response to water deprivation SoyBaseN/AISS
GO:0009693GO-bp Annotation by Michelle Graham. GO Biological Process: ethylene biosynthetic process SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009863GO-bp Annotation by Michelle Graham. GO Biological Process: salicylic acid mediated signaling pathway SoyBaseN/AISS
GO:0010363GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response SoyBaseN/AISS
GO:0042538GO-bp Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response SoyBaseN/AISS
GO:0043069GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of programmed cell death SoyBaseN/AISS
GO:0051707GO-bp Annotation by Michelle Graham. GO Biological Process: response to other organism SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF05678PFAM VQ motif JGI ISS
UniRef100_I1NE88UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NE88_SOYBN SoyBaseE_val: 1.00E-163ISS
UniRef100_I6ZTV0UniRef Annotation by Michelle Graham. Most informative UniRef hit: VQ motif-containing protein n=1 Tax=Phaseolus vulgaris RepID=I6ZTV0_PHAVU SoyBaseE_val: 6.00E-12ISS

Expression Patterns of Glyma20g15230
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g15230 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g064500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g15230
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g15230
>Glyma20g15230.1   sequence type=CDS   gene model=Glyma20g15230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACCCAAACCATGTCAGGCCCAAATGACAGCTGGCTCCAATTCTACAACCAAAATTCCACACCTTCAATCCCTGACTTCACCGTGAGTACTGCTAATGTTACCACTACTACTATCGTTGCGGCCACGAGTCCTTCACAGGACATGTTGAATTCGAGTTCATCAGGCCCGACCCATTTAAGCCCGGAAGGGCGCGTGGCGAAGCCCACCCGCCGTCGCTCCCGGGCCTCGCGGCGAACTCCGACCACTCTGCTAAACACGGACACCACAAACTTCCGGGCCATGGTCCAACAATTCACCGGAGGCCCGAGTGCACCATATGCATCAAACCCATCATTGGCACCACATGTTTTGCCAAACCTCATGGGCTTTGGGTTCCCCTCACGCCCTGTTCCGAGCCCAACCACCCTCGTCATGACGTCATCACCCCCTATATCCTACCTTCAACAACAACACATGTTTCAGCAGCAAAATCAACAGTACAATTTGTATAGTACTGGTGGTGGTGGCACACAAGGTGGTGGAGACAGCAACAACAACAGAATGTTTTTTCAGAGACTAAGTAACAACAACGTTAACCCTATAATGAGTCTTCCAACAAGCAATGTTGTTGTTAGCAATAATAACAACCGTGATGGTGATGGTGGGGCTGTGAATACGCATCATGGACGCTTCCTCCCGAACACTTCTTCTTCTTCTTGA
Predicted protein sequences of Glyma20g15230
>Glyma20g15230.1   sequence type=predicted peptide   gene model=Glyma20g15230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTQTMSGPNDSWLQFYNQNSTPSIPDFTVSTANVTTTTIVAATSPSQDMLNSSSSGPTHLSPEGRVAKPTRRRSRASRRTPTTLLNTDTTNFRAMVQQFTGGPSAPYASNPSLAPHVLPNLMGFGFPSRPVPSPTTLVMTSSPPISYLQQQHMFQQQNQQYNLYSTGGGGTQGGGDSNNNRMFFQRLSNNNVNPIMSLPTSNVVVSNNNNRDGDGGAVNTHHGRFLPNTSSSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo