Glyma20g14980 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g14980

Feature Type:	gene_model
Chromosome:	Gm20
Start:	20364412
stop:	20365565
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g14980

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G01170	AT	Annotation by Michelle Graham. TAIR10: bidirectional amino acid transporter 1 \| chr2:102364-104462 REVERSE LENGTH=516	SoyBase	E_val: 6.00E-29	ISS
GO:0003333	GO-bp	Annotation by Michelle Graham. GO Biological Process: amino acid transmembrane transport	SoyBase	N/A	ISS
GO:0015812	GO-bp	Annotation by Michelle Graham. GO Biological Process: gamma-aminobutyric acid transport	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0005313	GO-mf	Annotation by Michelle Graham. GO Molecular Function: L-glutamate transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015171	GO-mf	Annotation by Michelle Graham. GO Molecular Function: amino acid transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015180	GO-mf	Annotation by Michelle Graham. GO Molecular Function: L-alanine transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015181	GO-mf	Annotation by Michelle Graham. GO Molecular Function: arginine transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015185	GO-mf	Annotation by Michelle Graham. GO Molecular Function: gamma-aminobutyric acid transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015189	GO-mf	Annotation by Michelle Graham. GO Molecular Function: L-lysine transmembrane transporter activity	SoyBase	N/A	ISS
PTHR11785	Panther	AMINO ACID TRANSPORTER	JGI		ISS
PTHR11785:SF13	Panther	AMINO ACID TRANSPORTER-RELATED	JGI		ISS
PF00324	PFAM	Amino acid permease	JGI		ISS
UniRef100_G7JC64	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Amino-acid permease, putative n=1 Tax=Medicago truncatula RepID=G7JC64_MEDTR	SoyBase	E_val: 3.00E-83	ISS
UniRef100_I1KBM8	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KBM8_SOYBN	SoyBase	E_val: 2.00E-87	ISS

Expression Patterns of Glyma20g14980

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g14980 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma20g14980

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g14980

Limit To All Plant Sequences

>Glyma20g14980.1   sequence type=CDS   gene model=Glyma20g14980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAGCAAGAACTGAGAAGAGAAATGACTCTGGCAATATCATTTTCCACAATGACCCTTTTCACAAGAATTACACCTCTCTATGGTTCTAGTCTTCAATATGCCGGCCTTGCAACTCTTGTTTGGGGGTGGATAGTGGTTTCTTTCTTCACTTGGTTTGTTGGGATTGCAATGGCTGAGATATGCTCATCCTTCCCGATGACTGGTTCTCTGTACTTTTGGGCTGCCCATTTAGCTGGTCCAAAATGGGGACCATTTTCTTCATGGGACTCAGGTAATATGGCATATGCAAGATCACAAACGTTGCAGAGTATAATCCTACTCTCAACTGGCACAAATAAAGGTGGAGGGTACTTCACTCCAAAATGGCTATTCTTATGTATGTATATTGGCCTCACTATTACATGGGAAGCACTAAACACATTTGCATTGGAAGTGATTGATTTGATCGATATAGTTTCAATATGGTGGCAG

Predicted protein sequences of Glyma20g14980

Limit To All Plant Sequences

>Glyma20g14980.1   sequence type=predicted peptide   gene model=Glyma20g14980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KQELRREMTLAISFSTMTLFTRITPLYGSSLQYAGLATLVWGWIVVSFFTWFVGIAMAEICSSFPMTGSLYFWAAHLAGPKWGPFSSWDSGNMAYARSQTLQSIILLSTGTNKGGGYFTPKWLFLCMYIGLTITWEALNTFALEVIDLIDIVSIWWQ

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain