SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g14866

Feature Type:gene_model
Chromosome:Gm20
Start:20304126
stop:20304536
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g14866
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G35290AT Annotation by Michelle Graham. TAIR10: glutamate receptor 2 | chr4:16790290-16793461 FORWARD LENGTH=912 SoyBaseE_val: 7.00E-12ISS
GO:0006810GO-bp Annotation by Michelle Graham. GO Biological Process: transport SoyBaseN/AISS
GO:0006874GO-bp Annotation by Michelle Graham. GO Biological Process: cellular calcium ion homeostasis SoyBaseN/AISS
GO:0006883GO-bp Annotation by Michelle Graham. GO Biological Process: cellular sodium ion homeostasis SoyBaseN/AISS
GO:0009416GO-bp Annotation by Michelle Graham. GO Biological Process: response to light stimulus SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0030007GO-bp Annotation by Michelle Graham. GO Biological Process: cellular potassium ion homeostasis SoyBaseN/AISS
GO:0005576GO-cc Annotation by Michelle Graham. GO Cellular Compartment: extracellular region SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0004970GO-mf Annotation by Michelle Graham. GO Molecular Function: ionotropic glutamate receptor activity SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0005217GO-mf Annotation by Michelle Graham. GO Molecular Function: intracellular ligand-gated ion channel activity SoyBaseN/AISS
GO:0005234GO-mf Annotation by Michelle Graham. GO Molecular Function: extracellular-glutamate-gated ion channel activity SoyBaseN/AISS
PTHR18966Panther IONOTROPIC GLUTAMATE RECEPTOR-RELATED JGI ISS
PTHR18966:SF7Panther gb def: agcp6329 [anopheles gambiae str. pest] JGI ISS
UniRef100_G7IK73UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutamate receptor 2.7 n=1 Tax=Medicago truncatula RepID=G7IK73_MEDTR SoyBaseE_val: 5.00E-33ISS
UniRef100_UPI000233B1FDUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B1FD related cluster n=1 Tax=unknown RepID=UPI000233B1FD SoyBaseE_val: 1.00E-61ISS

Expression Patterns of Glyma20g14866
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g14866 not represented in the dataset
Glyma20g14866 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g14866 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.19g085800 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g14866
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g14866
>Glyma20g14866.1   sequence type=CDS   gene model=Glyma20g14866   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACAGAATTTTCAAATAATCTAATGCAGATGTTCCAGAAAGGCTCGCCAGTGGCCAGAGACGTGTCAAAAGCTATATTACATCTCTCAGAAAAAGCAGAGCTGAAGAGATTGGAAGAGAAGTGGTTGATTACCTCACCGGCATCATGCTCCAACGTGACCTCCGATGATACGGACAGTTTGAAGCTGAGAAGTTTATGGATTCTATATGTCATCTCAGGTGCCACTTCCACCATTTGTGTGCTACTATCAGCCATCCAATCTCTAGTAAAATCCTGTCACCAATGTCAAGCAGTGGCACCAGAAGGCAATGACACACCAAGTGATCATAAAGTGTGGGAGAACAAATAA
Predicted protein sequences of Glyma20g14866
>Glyma20g14866.1   sequence type=predicted peptide   gene model=Glyma20g14866   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTEFSNNLMQMFQKGSPVARDVSKAILHLSEKAELKRLEEKWLITSPASCSNVTSDDTDSLKLRSLWILYVISGATSTICVLLSAIQSLVKSCHQCQAVAPEGNDTPSDHKVWENK*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo