SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g14814): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g14814): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g14814

Feature Type:gene_model
Chromosome:Gm20
Start:20185210
stop:20186365
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G10630AT Annotation by Michelle Graham. TAIR10: ADP-ribosylation factor A1F | chr1:3513189-3514230 REVERSE LENGTH=181 SoyBaseE_val: 7.00E-49ISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0007264GO-bp Annotation by Michelle Graham. GO Biological Process: small GTPase mediated signal transduction SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005774GO-cc Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005507GO-mf Annotation by Michelle Graham. GO Molecular Function: copper ion binding SoyBaseN/AISS
GO:0005525GO-mf Annotation by Michelle Graham. GO Molecular Function: GTP binding SoyBaseN/AISS
GO:0016004GO-mf Annotation by Michelle Graham. GO Molecular Function: phospholipase activator activity SoyBaseN/AISS
PTHR11711Panther ARF-RELATED JGI ISS
PF00025PFAM ADP-ribosylation factor family JGI ISS
UniRef100_G7K590UniRef Annotation by Michelle Graham. Most informative UniRef hit: ADP-ribosylation factor n=1 Tax=Medicago truncatula RepID=G7K590_MEDTR SoyBaseE_val: 3.00E-52ISS
UniRef100_UPI000233DC70UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DC70 related cluster n=1 Tax=unknown RepID=UPI000233DC70 SoyBaseE_val: 7.00E-59ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g14814 not represented in the dataset

Glyma20g14814 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g14814.2   sequence type=transcript   gene model=Glyma20g14814   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAAAGAAAAAACAGAAAAGAATTCTAAGGCTTAAATATTGGTTGAACCAGAGGCAACAATGGGTTTGACGGTGTCACCGCTATTGAGATTGTTTTATGCAAGGAAAGAAATAAGGATTCTGATGGTGGGTCTTGATGTTGCTGGGAAACCAACAATACTCTACAAACTGAAACTTGGAGAAATAGTCACTACAACAATACCCACAATAGGCTTCAATGTGGAGACTGTTGAGTACAAAAATGTCAGCTTCACCGTCTGGGATGTGGGAGGACAGGACAAGAATACACAAGGTCTTATCTTTGTGGTAGACAGTAACGATAGGGAAAGAATTTTAGAAGCCAGGGATGAGTTATCTTTG

>Glyma20g14814.1   sequence type=CDS   gene model=Glyma20g14814   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTTGACGGTGTCACCGCTATTGAGATTGTTTTATGCAAGGAAAGAAATAAGGATTCTGATGGTGGGTCTTGATGTTGCTGGGAAACCAACAATACTCTACAAACTGAAACTTGGAGAAATAGTCACTACAACAATACCCACAATAGGCTTCAATGTGGAGACTGTTGAGTACAAAAATGTCAGCTTCACCGTCTGGGATGTGGGAGGACAGGACAAGAATACACAAGGTCTTATCTTTGTGGTAGACAGTAACGATAGGGAAAGAATTTTAGAAGCCAGGGATGAGTTATCTTTG

>Glyma20g14814.2   sequence type=CDS   gene model=Glyma20g14814   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTTTGACGGTGTCACCGCTATTGAGATTGTTTTATGCAAGGAAAGAAATAAGGATTCTGATGGTGGGTCTTGATGTTGCTGGGAAACCAACAATACTCTACAAACTGAAACTTGGAGAAATAGTCACTACAACAATACCCACAATAGGCTTCAATGTGGAGACTGTTGAGTACAAAAATGTCAGCTTCACCGTCTGGGATGTGGGAGGACAGGACAAGAATACACAAGGTCTTATCTTTGTGGTAGACAGTAACGATAGGGAAAGAATTTTAGAAGCCAGGGATGAGTTATCTTTG

>Glyma20g14814.1   sequence type=predicted peptide   gene model=Glyma20g14814   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLTVSPLLRLFYARKEIRILMVGLDVAGKPTILYKLKLGEIVTTTIPTIGFNVETVEYKNVSFTVWDVGGQDKNTQGLIFVVDSNDRERILEARDELSL

>Glyma20g14814.2   sequence type=predicted peptide   gene model=Glyma20g14814   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGLTVSPLLRLFYARKEIRILMVGLDVAGKPTILYKLKLGEIVTTTIPTIGFNVETVEYKNVSFTVWDVGGQDKNTQGLIFVVDSNDRERILEARDELSL







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo