SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g13798): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g13798): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g13798

Feature Type:gene_model
Chromosome:Gm20
Start:18973616
stop:18975334
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G27740AT Annotation by Michelle Graham. TAIR10: carbamoyl phosphate synthetase A | chr3:10281470-10283792 REVERSE LENGTH=358 SoyBaseE_val: 3.00E-16ISS
GO:0001510GO-bp Annotation by Michelle Graham. GO Biological Process: RNA methylation SoyBaseN/AISS
GO:0006164GO-bp Annotation by Michelle Graham. GO Biological Process: purine nucleotide biosynthetic process SoyBaseN/AISS
GO:0006543GO-bp Annotation by Michelle Graham. GO Biological Process: glutamine catabolic process SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0016036GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation SoyBaseN/AISS
GO:0070409GO-bp Annotation by Michelle Graham. GO Biological Process: carbamoyl phosphate biosynthetic process SoyBaseN/AISS
GO:0005951GO-cc Annotation by Michelle Graham. GO Cellular Compartment: carbamoyl-phosphate synthase complex SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0004088GO-mf Annotation by Michelle Graham. GO Molecular Function: carbamoyl-phosphate synthase (glutamine-hydrolyzing) activity SoyBaseN/AISS
PTHR11405Panther CARBAMOYLTRANSFERASE RELATED JGI ISS
PF00988PFAM Carbamoyl-phosphate synthase small chain, CPSase domain JGI ISS
UniRef100_B9V283UniRef Annotation by Michelle Graham. Most informative UniRef hit: Plastid carbamoylphosphate synthetase small subunit 2 n=1 Tax=Medicago truncatula RepID=B9V283_MEDTR SoyBaseE_val: 1.00E-33ISS
UniRef100_C6TER7UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TER7_SOYBN SoyBaseE_val: 5.00E-47ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g13798 not represented in the dataset

Glyma20g13798 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g057200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g13798.1   sequence type=CDS   gene model=Glyma20g13798   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGGAAGCTGCCGACCCTACCTGGAACAAAGAAAAGGAAAGTAGAAGAAAGGGTGAGTGGTTCTTCAGACATATCTGTAACGTTGTTTCTGTGAGAGCATCAATGGCGACAAAAGCTTTGTCCTTCGCTCTGTCTCTCAATGACCTCACCAACAAGCACTTCTCTTCCAATACGCCACACACCGCCACTAAAGTTTCCGTCTTTACTGTCCAATGCTCTTCTTCGGGTGGTGGAGAGAGGCCTTGGAAGAATTCAAATGCTAGACTTGTGCTTGAAGATGGTTCAATTTGGAAAGCAAAATCATTTGGTGCTTCGGGGACTCAAGTTGGCGAAGTTTTTTTTAATACATCATTGATAGGATGA

>Glyma20g13798.1   sequence type=predicted peptide   gene model=Glyma20g13798   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVEAADPTWNKEKESRRKGEWFFRHICNVVSVRASMATKALSFALSLNDLTNKHFSSNTPHTATKVSVFTVQCSSSGGGERPWKNSNARLVLEDGSIWKAKSFGASGTQVGEVFFNTSLIG*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo