Glyma20g12940 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g12940

Feature Type:	gene_model
Chromosome:	Gm20
Start:	18273532
stop:	18274140
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g12940

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G05860	AT	Annotation by Michelle Graham. TAIR10: MADS-box transcription factor family protein \| chr3:1751655-1752355 REVERSE LENGTH=207	SoyBase	E_val: 1.00E-35	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0046983	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein dimerization activity	SoyBase	N/A	ISS
PTHR11945	Panther	MADS BOX PROTEIN	JGI		ISS
PTHR11945:SF69	Panther	AGL80/FEM111 (AGAMOUS-LIKE80), DNA BINDING / TRANS	JGI		ISS
PF00319	PFAM	SRF-type transcription factor (DNA-binding and dimerisation domain)	JGI		ISS
UniRef100_G7J8R0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Agamous-like MADS-box protein AGL80 n=1 Tax=Medicago truncatula RepID=G7J8R0_MEDTR	SoyBase	E_val: 1.00E-33	ISS
UniRef100_I1NE71	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NE71_SOYBN	SoyBase	E_val: 1.00E-64	ISS

Expression Patterns of Glyma20g12940

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g12940 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma20g12940

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g12940

Limit To All Plant Sequences

>Glyma20g12940.2   sequence type=CDS   gene model=Glyma20g12940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTAGGAAGAAGGTGGACCTTTCATACATAACCAACGCCCGGAAGAGGAAGGCTACATTAAGCAAAAGGAAGAATGGTTTGATCAAGAAGATGGATGAAATCAGCACTCTTTGTGGGATTGAAGCATGTGCTATATTTTATACTCCCAATAATCCCCAGCCAGAGGTTTGGCCATCTGATTCGGGAGCCCAAAGTGTGCTTTCTAGGTTTAGGAAAGTGTCTGAACTAGAACAAAGCAAAAAAAAGTTGAGTCAAGAGAGTTTTTTGAGGCAGAGGATTAACAAAGCCAAGTACAACTTGGGAAACTAA

Predicted protein sequences of Glyma20g12940

Limit To All Plant Sequences

>Glyma20g12940.2   sequence type=predicted peptide   gene model=Glyma20g12940   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MARKKVDLSYITNARKRKATLSKRKNGLIKKMDEISTLCGIEACAIFYTPNNPQPEVWPSDSGAQSVLSRFRKVSELEQSKKKLSQESFLRQRINKAKYNLGN*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain