|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G26300 | AT | Annotation by Michelle Graham. TAIR10: cytochrome P450, family 71, subfamily B, polypeptide 34 | chr3:9639199-9640866 REVERSE LENGTH=500 | SoyBase | E_val: 6.00E-18 | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0005506 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: iron ion binding | SoyBase | N/A | ISS |
| GO:0009055 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron carrier activity | SoyBase | N/A | ISS |
| GO:0016705 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | SoyBase | N/A | ISS |
| GO:0019825 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxygen binding | SoyBase | N/A | ISS |
| GO:0020037 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: heme binding | SoyBase | N/A | ISS |
| PTHR24298 | Panther | FAMILY NOT NAMED | JGI | ISS | |
| PTHR24298:SF44 | Panther | JGI | ISS | ||
| PF00067 | PFAM | Cytochrome P450 | JGI | ISS | |
| UniRef100_Q8W228 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome P450 n=1 Tax=Pyrus communis RepID=Q8W228_PYRCO | SoyBase | E_val: 8.00E-25 | ISS |
| UniRef100_UPI0002338FE9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI0002338FE9 related cluster n=1 Tax=unknown RepID=UPI0002338FE9 | SoyBase | E_val: 9.00E-39 | ISS |
|
Glyma20g11633 not represented in the dataset |
Glyma20g11633 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.20g053900 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g11633.1 sequence type=CDS gene model=Glyma20g11633 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCTTCTACGCAACCAAAGAGTCCATACCTCAGATATTGTTGAGGTGTTTTATCCTGAGAGATTTGCCAATAGCAATGTGGACATGAGGGGATATGACATTATACTTTTACCATTTGCTTCTGGTCGTAGAGGCTGCCATAGGATTCATTTGGGTCTAACTACTATTAAGATTGTTCTAGCTCAATTGGTGCACTGCTTCAATTGGGAACTTCCATTAGGCATGTCCCCTGATGACTTGGACATGCTGAGAAATTTGGCCTCACAATTCCAAGAAGTGGTCGCTTGCTAG
>Glyma20g11633.1 sequence type=predicted peptide gene model=Glyma20g11633 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MLLRNQRVHTSDIVEVFYPERFANSNVDMRGYDIILLPFASGRRGCHRIHLGLTTIKIVLAQLVHCFNWELPLGMSPDDLDMLRNLASQFQEVVAC*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||