Glyma20g11177 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g11177): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g11177): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g11177

Feature Type:	gene_model
Chromosome:	Gm20
Start:	15696388
stop:	15698135
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g11177

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G47770	AT	Annotation by Michelle Graham. TAIR10: farnesyl diphosphate synthase 1 \| chr5:19345297-19347415 FORWARD LENGTH=384	SoyBase	E_val: 9.00E-76	ISS
GO:0006084	GO-bp	Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process	SoyBase	N/A	ISS
GO:0006598	GO-bp	Annotation by Michelle Graham. GO Biological Process: polyamine catabolic process	SoyBase	N/A	ISS
GO:0006816	GO-bp	Annotation by Michelle Graham. GO Biological Process: calcium ion transport	SoyBase	N/A	ISS
GO:0007030	GO-bp	Annotation by Michelle Graham. GO Biological Process: Golgi organization	SoyBase	N/A	ISS
GO:0009651	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to salt stress	SoyBase	N/A	ISS
GO:0009698	GO-bp	Annotation by Michelle Graham. GO Biological Process: phenylpropanoid metabolic process	SoyBase	N/A	ISS
GO:0016126	GO-bp	Annotation by Michelle Graham. GO Biological Process: sterol biosynthetic process	SoyBase	N/A	ISS
GO:0016132	GO-bp	Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process	SoyBase	N/A	ISS
GO:0030003	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis	SoyBase	N/A	ISS
GO:0042398	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular modified amino acid biosynthetic process	SoyBase	N/A	ISS
GO:0045337	GO-bp	Annotation by Michelle Graham. GO Biological Process: farnesyl diphosphate biosynthetic process	SoyBase	N/A	ISS
GO:0070838	GO-bp	Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0004161	GO-mf	Annotation by Michelle Graham. GO Molecular Function: dimethylallyltranstransferase activity	SoyBase	N/A	ISS
GO:0004337	GO-mf	Annotation by Michelle Graham. GO Molecular Function: geranyltranstransferase activity	SoyBase	N/A	ISS
PTHR11525	Panther	FARNESYL-PYROPHOSPHATE SYNTHETASE	JGI		ISS
PF00348	PFAM	Polyprenyl synthetase	JGI		ISS
UniRef100_D7NM49	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Farnesyl-diphosphate synthase n=1 Tax=Glycyrrhiza uralensis RepID=D7NM49_GLYUR	SoyBase	E_val: 1.00E-84	ISS
UniRef100_UPI000233DC11	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DC11 related cluster n=1 Tax=unknown RepID=UPI000233DC11	SoyBase	E_val: 8.00E-101	ISS

Expression Patterns of Glyma20g11177

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g11177 not represented in the dataset	Glyma20g11177 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g11177 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g047100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g11177

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g11177

Limit To All Plant Sequences

>Glyma20g11177.1   sequence type=CDS   gene model=Glyma20g11177   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTTCACTATGCTTCATATTTTTGCCAAGACGTCGGCAAGGGTGAGGGTTCCGATGACGTTGGTTCAGATGCTCTAGACTTTGAGGGACTCACACCAGTCGATGTTAGGACGGCCCATGACACCGGTGGTGTTGAAGACATGAGTGGGCTTGAGAGGGAGGTGCCGTTTTGGAGGCGGCCAGAGCTGTATTGGAAGGGGATGTCCTGGGCACGACAGAGGTACAAGACTGCATATTTTTCATTTTACCTTCCAGTTGCATGTGCATTGCTTATGGCGGGTGAGGATCTAGACAAAAATGTTGATGTAAAGAACATTCTTGTTGAGATGGGAACATACTTTCAAGTACAGGATTGCTTTGGTGATCCTCAAACAATTGGAAAGATAGGTACAGATATTGAAGATTTCAAGTGCTCTTGGTTAATTGTGAAAGCCTTCGAACTTAGTAATGAACAACAAAAGAAATTTCTACAAGAGAACTATGGTAAGCCAGATCCAGAAAATGTTGCTAAAGTAAAGGCCCTATACAATGAGCTTAATCTTCAGGGTGTATTTGAGGAGTACGAGAGTGGGAGCTATGTGAAGCTTGTATCCTCCATTGAAGCTCATCCTAGCAAAGCAGTTCAAGTTGTATTGAAGTCCTTTTTGGCTAAAATTTACAAGAGGCAGAAGTAG

Predicted protein sequences of Glyma20g11177

Limit To All Plant Sequences

>Glyma20g11177.1   sequence type=predicted peptide   gene model=Glyma20g11177   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MFHYASYFCQDVGKGEGSDDVGSDALDFEGLTPVDVRTAHDTGGVEDMSGLEREVPFWRRPELYWKGMSWARQRYKTAYFSFYLPVACALLMAGEDLDKNVDVKNILVEMGTYFQVQDCFGDPQTIGKIGTDIEDFKCSWLIVKAFELSNEQQKKFLQENYGKPDPENVAKVKALYNELNLQGVFEEYESGSYVKLVSSIEAHPSKAVQVVLKSFLAKIYKRQK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain