Glyma20g10941 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g10941): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g10941): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g10941

Feature Type:	gene_model
Chromosome:	Gm20
Start:	15392830
stop:	15395692
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g10941

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G12520	AT	Annotation by Michelle Graham. TAIR10: sulfate transporter 4;2 \| chr3:3967976-3971891 REVERSE LENGTH=661	SoyBase	E_val: 1.00E-20	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0008272	GO-bp	Annotation by Michelle Graham. GO Biological Process: sulfate transport	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0008271	GO-mf	Annotation by Michelle Graham. GO Molecular Function: secondary active sulfate transmembrane transporter activity	SoyBase	N/A	ISS
GO:0015116	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sulfate transmembrane transporter activity	SoyBase	N/A	ISS
PF00916	PFAM	Sulfate transporter family	JGI		ISS
UniRef100_E9BVB5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Sulfate transporter (Fragment) n=1 Tax=Astragalus racemosus RepID=E9BVB5_9FABA	SoyBase	E_val: 2.00E-23	ISS
UniRef100_I1N522	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N522_SOYBN	SoyBase	E_val: 3.00E-26	ISS

Expression Patterns of Glyma20g10941

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g10941 not represented in the dataset	Glyma20g10941 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g10941 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g048200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g10941

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g10941

Limit To All Plant Sequences

>Glyma20g10941.1   sequence type=CDS   gene model=Glyma20g10941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTGTATAATGGGACTCTTGAGGTATTTTCATCATTCCTCATTTTTATCAATAAGGAATCCATGCATGAAACATGGTTGTAGTAATGCCATGATAATTGTAATGGCTTATGTTCGAAAATCGAGGAAGTACTTGCGATTCTTGAAAGCTGCAGGTCCTCTTACAACAGTAGTTTTGGGAACAACTTTTACAAAAATATTTCATCCATCATCAATTTCTTTGGCGAGTGGAGATATACCTCAAGGCCTACCAAAATTTTCTGTTCCAAAATCTTTTGAGTATGCATAG

Predicted protein sequences of Glyma20g10941

Limit To All Plant Sequences

>Glyma20g10941.1   sequence type=predicted peptide   gene model=Glyma20g10941   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MECIMGLLRYFHHSSFLSIRNPCMKHGCSNAMIIVMAYVRKSRKYLRFLKAAGPLTTVVLGTTFTKIFHPSSISLASGDIPQGLPKFSVPKSFEYA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain