|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G12520 | AT | Annotation by Michelle Graham. TAIR10: sulfate transporter 4;2 | chr3:3967976-3971891 REVERSE LENGTH=661 | SoyBase | E_val: 1.00E-20 | ISS |
| GO:0006810 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transport | SoyBase | N/A | ISS |
| GO:0008272 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sulfate transport | SoyBase | N/A | ISS |
| GO:0055085 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transmembrane transport | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0016021 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane | SoyBase | N/A | ISS |
| GO:0005215 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: transporter activity | SoyBase | N/A | ISS |
| GO:0008271 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: secondary active sulfate transmembrane transporter activity | SoyBase | N/A | ISS |
| GO:0015116 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: sulfate transmembrane transporter activity | SoyBase | N/A | ISS |
| PF00916 | PFAM | Sulfate transporter family | JGI | ISS | |
| UniRef100_E9BVB5 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Sulfate transporter (Fragment) n=1 Tax=Astragalus racemosus RepID=E9BVB5_9FABA | SoyBase | E_val: 2.00E-23 | ISS |
| UniRef100_I1N522 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1N522_SOYBN | SoyBase | E_val: 3.00E-26 | ISS |
|
Glyma20g10941 not represented in the dataset |
Glyma20g10941 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.20g048200 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g10941.1 sequence type=CDS gene model=Glyma20g10941 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGAGTGTATAATGGGACTCTTGAGGTATTTTCATCATTCCTCATTTTTATCAATAAGGAATCCATGCATGAAACATGGTTGTAGTAATGCCATGATAATTGTAATGGCTTATGTTCGAAAATCGAGGAAGTACTTGCGATTCTTGAAAGCTGCAGGTCCTCTTACAACAGTAGTTTTGGGAACAACTTTTACAAAAATATTTCATCCATCATCAATTTCTTTGGCGAGTGGAGATATACCTCAAGGCCTACCAAAATTTTCTGTTCCAAAATCTTTTGAGTATGCATAG
>Glyma20g10941.1 sequence type=predicted peptide gene model=Glyma20g10941 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MECIMGLLRYFHHSSFLSIRNPCMKHGCSNAMIIVMAYVRKSRKYLRFLKAAGPLTTVVLGTTFTKIFHPSSISLASGDIPQGLPKFSVPKSFEYA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||