Glyma20g10840 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g10840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g10840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g10840

Feature Type:	gene_model
Chromosome:	Gm20
Start:	15105043
stop:	15105171
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g10840

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG00670	AT	Annotation by Michelle Graham. TAIR10: plastid-encoded CLP P \| chrC:69910-71882 REVERSE LENGTH=196	SoyBase	E_val: 8.00E-23	ISS
GO:0006091	GO-bp	Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy	SoyBase	N/A	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0006508	GO-bp	Annotation by Michelle Graham. GO Biological Process: proteolysis	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009532	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid stroma	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplastic endopeptidase Clp complex	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0004252	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity	SoyBase	N/A	ISS
GO:0008236	GO-mf	Annotation by Michelle Graham. GO Molecular Function: serine-type peptidase activity	SoyBase	N/A	ISS
PTHR10381	Panther	PROTEASE FAMILY S14 CLPP PROTEASE	JGI		ISS
PF00574	PFAM	Clp protease	JGI		ISS
UniRef100_Q2PMR0	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: ATP-dependent Clp protease proteolytic subunit n=1 Tax=Glycine max RepID=CLPP_SOYBN	SoyBase	E_val: 3.00E-21	ISS
UniRef100_Q2PMR0	UniRef	Annotation by Michelle Graham. Best UniRef hit: ATP-dependent Clp protease proteolytic subunit n=1 Tax=Glycine max RepID=CLPP_SOYBN	SoyBase	E_val: 3.00E-21	ISS

Expression Patterns of Glyma20g10840

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g10840 not represented in the dataset	Glyma20g10840 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g10840 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g048700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g10840

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g10840

Limit To All Plant Sequences

>Glyma20g10840.1   sequence type=CDS   gene model=Glyma20g10840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACTATCACAAGGGTTTATGTACAAAGAACGGGCAAACCTTTATGGGTTATATCCGAAGACATGGAAAGGGATGTTTTTATGTCAGCAGCAGAAGCCCAAGCTCACGGAATTGTAGATCTTGTAGCCGTT

Predicted protein sequences of Glyma20g10840

Limit To All Plant Sequences

>Glyma20g10840.1   sequence type=predicted peptide   gene model=Glyma20g10840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TITRVYVQRTGKPLWVISEDMERDVFMSAAEAQAHGIVDLVAV

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain