SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g10840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g10840): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g10840

Feature Type:gene_model
Chromosome:Gm20
Start:15105043
stop:15105171
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
ATCG00670AT Annotation by Michelle Graham. TAIR10: plastid-encoded CLP P | chrC:69910-71882 REVERSE LENGTH=196 SoyBaseE_val: 8.00E-23ISS
GO:0006091GO-bp Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy SoyBaseN/AISS
GO:0006354GO-bp Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation SoyBaseN/AISS
GO:0006508GO-bp Annotation by Michelle Graham. GO Biological Process: proteolysis SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009532GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid stroma SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009840GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplastic endopeptidase Clp complex SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0004252GO-mf Annotation by Michelle Graham. GO Molecular Function: serine-type endopeptidase activity SoyBaseN/AISS
GO:0008236GO-mf Annotation by Michelle Graham. GO Molecular Function: serine-type peptidase activity SoyBaseN/AISS
PTHR10381Panther PROTEASE FAMILY S14 CLPP PROTEASE JGI ISS
PF00574PFAM Clp protease JGI ISS
UniRef100_Q2PMR0UniRef Annotation by Michelle Graham. Most informative UniRef hit: ATP-dependent Clp protease proteolytic subunit n=1 Tax=Glycine max RepID=CLPP_SOYBN SoyBaseE_val: 3.00E-21ISS
UniRef100_Q2PMR0UniRef Annotation by Michelle Graham. Best UniRef hit: ATP-dependent Clp protease proteolytic subunit n=1 Tax=Glycine max RepID=CLPP_SOYBN SoyBaseE_val: 3.00E-21ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g10840 not represented in the dataset

Glyma20g10840 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g048700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g10840.1   sequence type=CDS   gene model=Glyma20g10840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ACTATCACAAGGGTTTATGTACAAAGAACGGGCAAACCTTTATGGGTTATATCCGAAGACATGGAAAGGGATGTTTTTATGTCAGCAGCAGAAGCCCAAGCTCACGGAATTGTAGATCTTGTAGCCGTT

>Glyma20g10840.1   sequence type=predicted peptide   gene model=Glyma20g10840   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TITRVYVQRTGKPLWVISEDMERDVFMSAAEAQAHGIVDLVAV







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo