|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G44890 | AT | Annotation by Michelle Graham. TAIR10: cytochrome P450, family 704, subfamily A, polypeptide 1 | chr2:18508392-18510308 REVERSE LENGTH=493 | SoyBase | E_val: 5.00E-14 | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005506 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: iron ion binding | SoyBase | N/A | ISS |
| GO:0009055 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron carrier activity | SoyBase | N/A | ISS |
| GO:0016705 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | SoyBase | N/A | ISS |
| GO:0019825 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxygen binding | SoyBase | N/A | ISS |
| GO:0020037 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: heme binding | SoyBase | N/A | ISS |
| UniRef100_B9IC23 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome P450 n=1 Tax=Populus trichocarpa RepID=B9IC23_POPTR | SoyBase | E_val: 2.00E-38 | ISS |
| UniRef100_UPI000233DC09 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233DC09 related cluster n=1 Tax=unknown RepID=UPI000233DC09 | SoyBase | E_val: 2.00E-70 | ISS |
|
Glyma20g10281 not represented in the dataset |
Glyma20g10281 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.20g050000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g10281.1 sequence type=CDS gene model=Glyma20g10281 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCCATCATCCATGGCTTTCCTTTCACATCCTTATTTCTTTGCAGCTTTATCTGCACCTTTGACTCTTTTGGTGGTCCAAATTCTGTTCAGAAAACTGAACAAAAGGCATAATAGAAAGAAGTACCACCCTGTTGCTGACACCATCTTCAATCAGATGCTAAACTTCAACAGGCTGCACCATTATATGACTGATCTTGCTGCCAAGCACAAGGCTTACAGGCTGCTCAACCCTTTCAGATATGAGGTTTACACCACTGAGCCAACTAATGTTGAGTATATACTCAAAACCAATTTTGAGAATTATGGAAAGGTGCTGGATTTGGATCTAAGAGAAAATATATGTTTCGGAAAGTGA
>Glyma20g10281.1 sequence type=predicted peptide gene model=Glyma20g10281 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MPSSMAFLSHPYFFAALSAPLTLLVVQILFRKLNKRHNRKKYHPVADTIFNQMLNFNRLHHYMTDLAAKHKAYRLLNPFRYEVYTTEPTNVEYILKTNFENYGKVLDLDLRENICFGK*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||