SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 157 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g08845): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g08845): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g08845

Feature Type:gene_model
Chromosome:Gm20
Start:12536217
stop:12538611
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G63310AT Annotation by Michelle Graham. TAIR10: nucleoside diphosphate kinase 2 | chr5:25372122-25373838 REVERSE LENGTH=231 SoyBaseE_val: 2.00E-81ISS
GO:0006165GO-bp Annotation by Michelle Graham. GO Biological Process: nucleoside diphosphate phosphorylation SoyBaseN/AISS
GO:0006183GO-bp Annotation by Michelle Graham. GO Biological Process: GTP biosynthetic process SoyBaseN/AISS
GO:0006228GO-bp Annotation by Michelle Graham. GO Biological Process: UTP biosynthetic process SoyBaseN/AISS
GO:0006241GO-bp Annotation by Michelle Graham. GO Biological Process: CTP biosynthetic process SoyBaseN/AISS
GO:0009411GO-bp Annotation by Michelle Graham. GO Biological Process: response to UV SoyBaseN/AISS
GO:0009585GO-bp Annotation by Michelle Graham. GO Biological Process: red, far-red light phototransduction SoyBaseN/AISS
GO:0009734GO-bp Annotation by Michelle Graham. GO Biological Process: auxin mediated signaling pathway SoyBaseN/AISS
GO:0019288GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway SoyBaseN/AISS
GO:0042542GO-bp Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009941GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope SoyBaseN/AISS
GO:0004550GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleoside diphosphate kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
KOG0888 KOG Nucleoside diphosphate kinase JGI ISS
PTHR11349Panther NUCLEOSIDE DIPHOSPHATE KINASE JGI ISS
PF00334PFAM Nucleoside diphosphate kinase JGI ISS
UniRef100_I1K081UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nucleoside diphosphate kinase n=1 Tax=Glycine max RepID=I1K081_SOYBN SoyBaseE_val: 3.00E-131ISS
UniRef100_UPI000233DC01UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233DC01 related cluster n=1 Tax=unknown RepID=UPI000233DC01 SoyBaseE_val: 5.00E-149ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g08845 not represented in the dataset

Glyma20g08845 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g045900 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g08845.1   sequence type=CDS   gene model=Glyma20g08845   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGCTGTGTGTGGAAGTTTTTGGGTCACATCCTCTCTTCCACGCTCACCCAAGTCCACTCTCCCTCTATTCCGCTCTACTCATCAACACCTAATAGCATTTCCTTCACAATTTCATCTTTTCTTATATCGCCCTCCTCCCTATGCCAATGCTAAAACCCTCTGTGCCAGAACCTCCTCCAAACCCGCCATTTTCCTTCCCCACTTAATTGCTTCTTTGGAACAAGTTGACCAGACTTACATAATGGTCAAGCCCGACGGCATGCAACGTGGCCTCGTGGGAGAAATTATTTTTAGGTTCGAGAAGAAGGGGTTTAAGTTAACCGACTTGAAGCTCTTCAAGTGCTCAAAGGAATTAGCTGAGGAGCATTACAAGGACCTAAAACAAAAGTCATTCTTCCCCAAGCTGATTGACTATATTACTTCAGGTCCTGTTGTGTGTATGGCTTGGGAGGGTGTTGGGGTAGTCGCATCGGCCCGTAAACTTATAGGTGCTACATATCCTCTTCAAGCTGAACCAGACACAATAAGAGGAGACCTTACTGTTCAGACACGAAAGAATGTTGTTCATGGCAGTGACAATCCTGAGAATGGCAAGCATGAAATAGGTAAGGCCTCTTATGCTATCCAGTTTAACCCAAATACATGCAACAAACATAGATGTGAATTGTGA

>Glyma20g08845.1   sequence type=predicted peptide   gene model=Glyma20g08845   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEAVCGSFWVTSSLPRSPKSTLPLFRSTHQHLIAFPSQFHLFLYRPPPYANAKTLCARTSSKPAIFLPHLIASLEQVDQTYIMVKPDGMQRGLVGEIIFRFEKKGFKLTDLKLFKCSKELAEEHYKDLKQKSFFPKLIDYITSGPVVCMAWEGVGVVASARKLIGATYPLQAEPDTIRGDLTVQTRKNVVHGSDNPENGKHEIGKASYAIQFNPNTCNKHRCEL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo