SoyBase
SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research
SoyBase
SoyBase transitions to NEW site on 10/1/2024
|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT3G12490 | AT | Annotation by Michelle Graham. TAIR10: cystatin B | chr3:3960523-3961777 REVERSE LENGTH=201 | SoyBase | E_val: 2.00E-40 | ISS |
| GO:0006972 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hyperosmotic response | SoyBase | N/A | ISS |
| GO:0006979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to oxidative stress | SoyBase | N/A | ISS |
| GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
| GO:0009414 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to water deprivation | SoyBase | N/A | ISS |
| GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
| GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
| GO:0004869 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: cysteine-type endopeptidase inhibitor activity | SoyBase | N/A | ISS |
| GO:0050897 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: cobalt ion binding | SoyBase | N/A | ISS |
| PTHR11413 | Panther | CYSTATIN FAMILY MEMBER | JGI | ISS | |
| PTHR11413:SF3 | Panther | CYSTATIN PRECURSOR | JGI | ISS | |
| PF00031 | PFAM | Cystatin domain | JGI | ISS | |
| UniRef100_C6SYG7 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=C6SYG7_SOYBN | SoyBase | E_val: 6.00E-63 | ISS |
| UniRef100_Q06445 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Cysteine proteinase inhibitor n=1 Tax=Vigna unguiculata RepID=CYTI_VIGUN | SoyBase | E_val: 5.00E-56 | ISS |
|
Glyma20g08800 not represented in the dataset |
Glyma20g08800 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Paralog | Evidence | Comments |
|---|---|---|
| Glyma13g04250 | IGC | Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3. |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.20g045500 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g08800.3 sequence type=CDS gene model=Glyma20g08800 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCAGCACTTGGTGGGAATCGTGATGTGACAGGAAGCCAGAACAGCGTTGAGATCGATGCTCTAGCTCGCTTTGCTGTTGAAGAACACAACAAAAAACAGAATGCCCTTTTGGAGTTTGAAAAGGTGGTAACTGCGAAACAGCAAGTGGTTTCTGGTACCTTGTACACCATCACTTTGGAGGCAAAAGATGGTGGGCAAAAGAAGGTTTATGAAGCCAAAGTTTGGGAGAAGTCATGGTTGAACTTCAAGGAGGTGCAAGAGTTCAAGCTTGTTGGAGATGCACCTGCATAG
>Glyma20g08800.3 sequence type=predicted peptide gene model=Glyma20g08800 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAALGGNRDVTGSQNSVEIDALARFAVEEHNKKQNALLEFEKVVTAKQQVVSGTLYTITLEAKDGGQKKVYEAKVWEKSWLNFKEVQEFKLVGDAPA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||
|
|
|
