Report for Sequence Feature Glyma20g08660
Feature Type: gene_model
Chromosome: Gm20
Start: 12185463
stop: 12185708
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma20g08660
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT2G29840 AT
Annotation by Michelle Graham. TAIR10: RING/U-box superfamily protein | chr2:12732387-12733983 REVERSE LENGTH=293
SoyBase E_val: 5.00E-14 ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0008270 GO-mf
Annotation by Michelle Graham. GO Molecular Function: zinc ion binding
SoyBase N/A ISS
PTHR22763 Panther
RING ZINC FINGER PROTEIN
JGI ISS
PF00097 PFAM
Zinc finger, C3HC4 type (RING finger)
JGI ISS
UniRef100_G7J4X3 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Ring finger protein n=1 Tax=Medicago truncatula RepID=G7J4X3_MEDTR
SoyBase E_val: 6.00E-14 ISS
UniRef100_I1NDZ0 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NDZ0_SOYBN
SoyBase E_val: 3.00E-44 ISS
Expression Patterns of Glyma20g08660
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Gene model name correspondences to Glyma20g08660 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
References for Glyma20g08660
Coding sequences of Glyma20g08660
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma20g08660.2 sequence type=CDS gene model=Glyma20g08660 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGAAGTGTCTATGCATGATTACAAAATGATTCCCGCATCTAGCGAAGCCATCCAGACGTTGTTGAAGAAATCTACGGTTCAAACACAGGATGAGTGTTGTTCCATCTGCTTGGAAGGTTTGGATATTAACGTTTACACAATGCCATGTAATCACATGTTTCATCATCAATGTATTGTGACCTGGTTGCAAAACAGTCATATGTGTCCCTTGTGTCGATACCCTCTACCTCTGCAAAAATTATAA
Predicted protein sequences of Glyma20g08660
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma20g08660.2 sequence type=predicted peptide gene model=Glyma20g08660 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MEVSMHDYKMIPASSEAIQTLLKKSTVQTQDECCSICLEGLDINVYTMPCNHMFHHQCIVTWLQNSHMCPLCRYPLPLQKL*