Glyma20g08500 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g08500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g08500): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g08500

Feature Type:	gene_model
Chromosome:	Gm20
Start:	11940215
stop:	11941861
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g08500

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G48500	AT	Annotation by Michelle Graham. TAIR10: Nucleic acid-binding, OB-fold-like protein \| chr3:17962209-17965408 FORWARD LENGTH=668	SoyBase	E_val: 1.00E-12	ISS
GO:0042793	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0009295	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleoid	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009508	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid chromosome	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0003723	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA binding	SoyBase	N/A	ISS
UniRef100_D6QX33	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Plastid RNA-binding protein n=1 Tax=Nicotiana benthamiana RepID=D6QX33_NICBE	SoyBase	E_val: 9.00E-11	ISS
UniRef100_UPI000233A8D8	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233A8D8 related cluster n=1 Tax=unknown RepID=UPI000233A8D8	SoyBase	E_val: 1.00E-17	ISS

Expression Patterns of Glyma20g08500

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g08500 not represented in the dataset	Glyma20g08500 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g08500 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma20g08500

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g08500

Limit To All Plant Sequences

>Glyma20g08500.1   sequence type=CDS   gene model=Glyma20g08500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTGGCAGAGAATGAGACACAAATCCTCACATCTTATAGTAAAACACAGTGGATTCACCAGCTGCAGCCAAAGGGATAAGAATTCAAGGACCAAAAATAATTATTGTGAAGAAGCCATCGAAGCGTTCAAAATGCTAAACCCTAACTACCGCAAGAAGAAAAGGGGGGAAATGGGACTCACCGAGGAAGAGTTCTACGCGAAGCACTCCTCCCCCGTCTCCTTGTCCGTACAGAGGAAGGAAGAGCTTGCGTTCATTCGCAAGGCGCATAAGGTGCAGGCGAGGAGGGTGATGCTGGAGGAGGTGGAGAGCTTTCAATATTGGATTGGCTCAATATTCTACACAGGTGCAGGTCATGTGGCGCAAGAGAGTAAGCCTAAGGAG

Predicted protein sequences of Glyma20g08500

Limit To All Plant Sequences

>Glyma20g08500.1   sequence type=predicted peptide   gene model=Glyma20g08500   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MWQRMRHKSSHLIVKHSGFTSCSQRDKNSRTKNNYCEEAIEAFKMLNPNYRKKKRGEMGLTEEEFYAKHSSPVSLSVQRKEELAFIRKAHKVQARRVMLEEVESFQYWIGSIFYTGAGHVAQESKPKE

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain