Glyma20g08423 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma20g08423

Feature Type:	gene_model
Chromosome:	Gm20
Start:	11830075
stop:	11830779
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g08423

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G70330	AT	Annotation by Michelle Graham. TAIR10: equilibrative nucleotide transporter 1 \| chr1:26502920-26504360 FORWARD LENGTH=450	SoyBase	E_val: 9.00E-23	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0016021	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: integral to membrane	SoyBase	N/A	ISS
GO:0005337	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside transmembrane transporter activity	SoyBase	N/A	ISS
GO:0010174	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleoside transmembrane transporter activity, against a concentration gradient	SoyBase	N/A	ISS
PTHR10332	Panther	EQUILIBRATIVE NUCLEOSIDE TRANSPORTER ENT (SLC29)	JGI		ISS
PTHR10332:SF3	Panther	EQUILIBRATIVE NUCLEOSIDE TRANSPORTER 4-RELATED	JGI		ISS
PF01733	PFAM	Nucleoside transporter	JGI		ISS
UniRef100_B9SH79	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nucleoside transporter, putative n=1 Tax=Ricinus communis RepID=B9SH79_RICCO	SoyBase	E_val: 3.00E-21	ISS
UniRef100_I1LNZ3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1LNZ3_SOYBN	SoyBase	E_val: 2.00E-26	ISS

Expression Patterns of Glyma20g08423

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g08423 not represented in the dataset	Glyma20g08423 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g08423 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g043200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g08423

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g08423

Limit To All Plant Sequences

>Glyma20g08423.1   sequence type=CDS   gene model=Glyma20g08423   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGATGCGTTGGTGCAGGGCTCCATTGTGGGTTGTGCCGACGAGTTGCCAGAGAGGTATATGCAAGCTATCATCGCTGGCACTACTGGCTCTGAACGTCTTTTGGGAAAGGTCAACCCTTTAAATGATTTCAGTTTACTTGGTTTTTGGCCAGAGGTTCATTTTGATACTCCAGTGACGATACTGACTTGCCTGTTAGGGCTTACTAATGGCTACCTAACCAGTGTATTGATTATTTTGATTCCTAAAATTGTAAAATTGCAGCATGCAGAAACTACAGGGATTATGAGTGTATTATTCTTAGGTTTTGGTCTAGCTGCTGGGTCTATTATAGCTTGGATTTGGGTCATCTGA

Predicted protein sequences of Glyma20g08423

Limit To All Plant Sequences

>Glyma20g08423.1   sequence type=predicted peptide   gene model=Glyma20g08423   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADALVQGSIVGCADELPERYMQAIIAGTTGSERLLGKVNPLNDFSLLGFWPEVHFDTPVTILTCLLGLTNGYLTSVLIILIPKIVKLQHAETTGIMSVLFLGFGLAAGSIIAWIWVI*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain