SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g08306): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g08306): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g08306

Feature Type:gene_model
Chromosome:Gm20
Start:11650354
stop:11650839
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G48520AT Annotation by Michelle Graham. TAIR10: GLU-ADT subunit B | chr1:17940185-17942272 FORWARD LENGTH=488 SoyBaseE_val: 3.00E-36ISS
GO:0006424GO-bp Annotation by Michelle Graham. GO Biological Process: glutamyl-tRNA aminoacylation SoyBaseN/AISS
GO:0016556GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA modification SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0016874GO-mf Annotation by Michelle Graham. GO Molecular Function: ligase activity SoyBaseN/AISS
GO:0016884GO-mf Annotation by Michelle Graham. GO Molecular Function: carbon-nitrogen ligase activity, with glutamine as amido-N-donor SoyBaseN/AISS
GO:0050567GO-mf Annotation by Michelle Graham. GO Molecular Function: glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity SoyBaseN/AISS
PTHR11659Panther GLUTAMYL-TRNA(GLN) AMIDOTRANSFERASE SUBUNIT B (MITOCHONDRIAL AND PROKARYOTIC) PET112-RELATED JGI ISS
PF02934PFAM GatB/GatE catalytic domain JGI ISS
UniRef100_I1K5J4UniRef Annotation by Michelle Graham. Best UniRef hit: Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 1 n=1 Tax=Glycine max RepID=I1K5J4_SOYBN SoyBaseE_val: 3.00E-46ISS
UniRef100_I1K5J4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial 1 n=1 Tax=Glycine max RepID=I1K5J4_SOYBN SoyBaseE_val: 3.00E-46ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g08306 not represented in the dataset

Glyma20g08306 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g042500 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma20g08306.1   sequence type=CDS   gene model=Glyma20g08306   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCATTTGTTTATGGCAGGTTGAAATAAAAAATTTGAACTCATTTTCATCAGTGATTAGAGCTATTCATTTTGAAATTTCTAGGCAGGTGCAACTCCATAGTGAAGGCCAGGAAGATCAGATAGTACAGGAAACTCCTTTATGGGAAGAAGGCTCTTCTCAGGCTAGTGCTATATTAACAATTGCAACGAGGAAAAAGGAAAGGCTTGGTGATTATCAATATTTTGCAGAACCAGACCTTCCAACAATAATCCTTTCTCAAGAATATGTTGATGGTATAAAAAATTCTTTACCAGAGCTTCTAGAAATTAAGCAGAGAAGATGA

>Glyma20g08306.1   sequence type=predicted peptide   gene model=Glyma20g08306   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVICLWQVEIKNLNSFSSVIRAIHFEISRQVQLHSEGQEDQIVQETPLWEEGSSQASAILTIATRKKERLGDYQYFAEPDLPTIILSQEYVDGIKNSLPELLEIKQRR*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo