|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
ATCG01090 | AT | Annotation by Michelle Graham. TAIR10: NADPH dehydrogenases | chrC:119244-119762 REVERSE LENGTH=172 | SoyBase | E_val: 1.00E-20 | ISS |
GO:0006091 | GO-bp | Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy | SoyBase | N/A | ISS |
GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
GO:0009773 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I | SoyBase | N/A | ISS |
GO:0010207 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem II assembly | SoyBase | N/A | ISS |
GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
GO:0019684 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction | SoyBase | N/A | ISS |
GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
GO:0003959 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADPH dehydrogenase activity | SoyBase | N/A | ISS |
GO:0008137 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity | SoyBase | N/A | ISS |
GO:0009055 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: electron carrier activity | SoyBase | N/A | ISS |
GO:0016651 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H | SoyBase | N/A | ISS |
GO:0051536 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: iron-sulfur cluster binding | SoyBase | N/A | ISS |
GO:0051539 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: 4 iron, 4 sulfur cluster binding | SoyBase | N/A | ISS |
UniRef100_Q2PMN6 | UniRef | Annotation by Michelle Graham. Best UniRef hit: NAD(P)H-quinone oxidoreductase subunit I, chloroplastic n=1 Tax=Glycine max RepID=NDHI_SOYBN | SoyBase | E_val: 4.00E-24 | ISS |
UniRef100_Q2PMN6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H-quinone oxidoreductase subunit I, chloroplastic n=1 Tax=Glycine max RepID=NDHI_SOYBN | SoyBase | E_val: 4.00E-24 | ISS |
Glyma20g08275 not represented in the dataset |
Glyma20g08275 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.20g042300 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g08275.1 sequence type=CDS gene model=Glyma20g08275 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTCCTTATGGTAAGTGGATTCATAAATTATAGTCAACAAATAGTTCGAGCTGCAAGGTACATTGGTCAAGGTTACACGATTACCCTATCTCATGCAAATAGGTTACCCGTAACTATTCAATATCCTTATGAAAAAATAATAGCACTTATCGAGCATACTCAGGAAAACTATTCTGACCCAAGAAACATATGTTATGAGGATTTCACCCCTGGCAGTTAA
>Glyma20g08275.1 sequence type=predicted peptide gene model=Glyma20g08275 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MFLMVSGFINYSQQIVRAARYIGQGYTITLSHANRLPVTIQYPYEKIIALIEHTQENYSDPRNICYEDFTPGS*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||