|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT4G39080 | AT | Annotation by Michelle Graham. TAIR10: vacuolar proton ATPase A3 | chr4:18209513-18214752 FORWARD LENGTH=821 | SoyBase | E_val: 3.00E-13 | ISS |
| GO:0000902 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell morphogenesis | SoyBase | N/A | ISS |
| GO:0006816 | GO-bp | Annotation by Michelle Graham. GO Biological Process: calcium ion transport | SoyBase | N/A | ISS |
| GO:0007030 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi organization | SoyBase | N/A | ISS |
| GO:0007033 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vacuole organization | SoyBase | N/A | ISS |
| GO:0009651 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to salt stress | SoyBase | N/A | ISS |
| GO:0015986 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled proton transport | SoyBase | N/A | ISS |
| GO:0016049 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell growth | SoyBase | N/A | ISS |
| GO:0031669 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to nutrient levels | SoyBase | N/A | ISS |
| GO:0032119 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sequestering of zinc ion | SoyBase | N/A | ISS |
| GO:0043181 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vacuolar sequestering | SoyBase | N/A | ISS |
| GO:0048193 | GO-bp | Annotation by Michelle Graham. GO Biological Process: Golgi vesicle transport | SoyBase | N/A | ISS |
| GO:0070072 | GO-bp | Annotation by Michelle Graham. GO Biological Process: vacuolar proton-transporting V-type ATPase complex assembly | SoyBase | N/A | ISS |
| GO:0000325 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0005773 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuole | SoyBase | N/A | ISS |
| GO:0005774 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0005886 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0009705 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plant-type vacuole membrane | SoyBase | N/A | ISS |
| GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
| GO:0016020 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: membrane | SoyBase | N/A | ISS |
| GO:0009678 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: hydrogen-translocating pyrophosphatase activity | SoyBase | N/A | ISS |
| GO:0016887 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: ATPase activity | SoyBase | N/A | ISS |
| GO:0045735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: nutrient reservoir activity | SoyBase | N/A | ISS |
| PTHR11629 | Panther | VACUOLAR PROTON ATPASES | JGI | ISS | |
| PTHR11629:SF11 | Panther | VACUOLAR PROTON ATPASE | JGI | ISS | |
| PF01496 | PFAM | V-type ATPase 116kDa subunit family | JGI | ISS | |
| UniRef100_Q8W4S4 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar proton ATPase a3 n=1 Tax=Arabidopsis thaliana RepID=VHAA3_ARATH | SoyBase | E_val: 1.00E-10 | ISS |
| UniRef100_Q8W4S4 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Vacuolar proton ATPase a3 n=1 Tax=Arabidopsis thaliana RepID=VHAA3_ARATH | SoyBase | E_val: 1.00E-10 | ISS |
|
Glyma20g08120 not represented in the dataset |
Glyma20g08120 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.20g041400 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g08120.1 sequence type=CDS gene model=Glyma20g08120 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGAAAATGTCAATTCTTCTTGGAGTAGCTCGAATGAACCAACTCTTTGTTGCACATATGAGAGTTTGCAAGTGGAGTCATCATGGTCATGAGGAATTTGAGTTCAGTGAAGTCTTTGTACATCAACTCATACATACCATAGAATTTGTACTGGGAGCAGTCTCTAATACAGATTTACCTCCTTCTATGGGCCCTTAG
>Glyma20g08120.1 sequence type=predicted peptide gene model=Glyma20g08120 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MKMSILLGVARMNQLFVAHMRVCKWSHHGHEEFEFSEVFVHQLIHTIEFVLGAVSNTDLPPSMGP*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||