Glyma20g06615 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g06615): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g06615): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g06615

Feature Type:	gene_model
Chromosome:	Gm20
Start:	8866521
stop:	8872387
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma20g06615

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G07740	AT	Annotation by Michelle Graham. TAIR10: homolog of yeast ADA2 2A \| chr3:2470014-2473062 REVERSE LENGTH=548	SoyBase	E_val: 3.00E-81	ISS
GO:0000956	GO-bp	Annotation by Michelle Graham. GO Biological Process: nuclear-transcribed mRNA catabolic process	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006396	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA processing	SoyBase	N/A	ISS
GO:0009409	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cold	SoyBase	N/A	ISS
GO:0009410	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to xenobiotic stimulus	SoyBase	N/A	ISS
GO:0022402	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell cycle process	SoyBase	N/A	ISS
GO:0043687	GO-bp	Annotation by Michelle Graham. GO Biological Process: post-translational protein modification	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0048481	GO-bp	Annotation by Michelle Graham. GO Biological Process: ovule development	SoyBase	N/A	ISS
GO:0048522	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of cellular process	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003677	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA binding	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
PTHR12374	Panther	TRANSCRIPTIONAL ADAPTOR 2 (ADA2)-RELATED	JGI		ISS
PTHR12374:SF12	Panther	MYB FAMILY TRANSCRIPTION FACTOR	JGI		ISS
PF00249	PFAM	Myb-like DNA-binding domain	JGI		ISS
PF00569	PFAM	Zinc finger, ZZ type,	JGI		ISS
UniRef100_G7J8V8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Histone acetyltransferase complex component n=1 Tax=Medicago truncatula RepID=G7J8V8_MEDTR	SoyBase	E_val: 7.00E-117	ISS
UniRef100_UPI000233DCCE	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233DCCE related cluster n=1 Tax=unknown RepID=UPI000233DCCE	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma20g06615

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g06615 not represented in the dataset	Glyma20g06615 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g06615 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.20g062300	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma20g06615

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma20g06615

Limit To All Plant Sequences

>Glyma20g06615.1   sequence type=CDS   gene model=Glyma20g06615   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGACACAAGGCCGTTCCATAAACAATATTGTTTGGCGGCAAGGCTTCAGTTTCAGAGGGGGAGAAATGGGTCGGTCCAGAGTTGCGTTGCGCTCCGCTGACGATGACCCAAACCACAGATCAAAGAGAAAAAAGGCTGCTCTGAATGTAGAAAATTCAGAAACCTTACCTACAGGCCAAGGAGTAACTACTAGCAAGGTATCTCTCTATCACTGCAATTATTGTAACAAAGATATTTCGGGGAAGATTCGCATCAAGTGTGCTGTCTGTCAAGATTTTGACCTCTGCTTAGAGTGCTTCTCTGTTGGTGCTGAGGTGACACCTCACAAAAGCAATCATCCATATCGGATTATGGATAATCTATCTTTTCCACTTATATGTACAGATTGGAATGCAGATGAAGAGTTGTTACTTCTAGAGGGCATTGAAACGTATGGATTTGGGAATTGGAATGAAGTTGCAGAATATGTTGGAACAAAAACCAAATCTCAATGTATTGACCACTATAATGCTGTATATATGAATTCGCCATGTTTTCCTCTCCCTGATTTGTCTCATGTTATGGGGAAGAACAAAGTGGAACTCTGTGCCATGGCGAAGGGACATGAAGCCAAGAAAGAATTTTCTCTGACTGCAGAGCTTACTCTGAAAGAAGAAGCTTTGTTCACTGATCGAATAAACTATGAAGAATCAAAGAATGCAGAAATCAATAATCAAACTATGTCTAGGTTAACCTCAGCATGTGGCAAAGCTTACCCAAGTACAATTAAGAAGGCATCCAACGTGATCCAAAATAATGGTGGAGTTAAGGTGGAA

Predicted protein sequences of Glyma20g06615

Limit To All Plant Sequences

>Glyma20g06615.1   sequence type=predicted peptide   gene model=Glyma20g06615   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MTQGRSINNIVWRQGFSFRGGEMGRSRVALRSADDDPNHRSKRKKAALNVENSETLPTGQGVTTSKVSLYHCNYCNKDISGKIRIKCAVCQDFDLCLECFSVGAEVTPHKSNHPYRIMDNLSFPLICTDWNADEELLLLEGIETYGFGNWNEVAEYVGTKTKSQCIDHYNAVYMNSPCFPLPDLSHVMGKNKVELCAMAKGHEAKKEFSLTAELTLKEEALFTDRINYEESKNAEINNQTMSRLTSACGKAYPSTIKKASNVIQNNGGVKVE

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain