SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma20g06571): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma20g06571): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma20g06571

Feature Type:gene_model
Chromosome:Gm20
Start:8518490
stop:8519936
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma20g06571
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G25910AT Annotation by Michelle Graham. TAIR10: 3'-5' exonuclease domain-containing protein / K homology domain-containing protein / KH domain-containing protein | chr2:11049379-11051997 REVERSE LENGTH=341 SoyBaseE_val: 2.00E-43ISS
GO:0006139GO-bp Annotation by Michelle Graham. GO Biological Process: nucleobase-containing compound metabolic process SoyBaseN/AISS
GO:0006623GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to vacuole SoyBaseN/AISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0005622GO-cc Annotation by Michelle Graham. GO Cellular Compartment: intracellular SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
GO:0008408GO-mf Annotation by Michelle Graham. GO Molecular Function: 3'-5' exonuclease activity SoyBaseN/AISS
PTHR12124Panther POLYMYOSITIS/SCLERODERMA AUTOANTIGEN-RELATED JGI ISS
PF01612PFAM 3'-5' exonuclease JGI ISS
UniRef100_C6TMT6UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TMT6_SOYBN SoyBaseE_val: 5.00E-58ISS
UniRef100_Q2V9B5UniRef Annotation by Michelle Graham. Most informative UniRef hit: 3'-5' exonuclease domain-containing protein-like n=1 Tax=Solanum tuberosum RepID=Q2V9B5_SOLTU SoyBaseE_val: 7.00E-42ISS

Expression Patterns of Glyma20g06571
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma20g06571 not represented in the dataset
Glyma20g06571 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma20g06571 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.20g062400 Wm82.a2.v1IGC As supplied by JGI

References for Glyma20g06571
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma20g06571
>Glyma20g06571.1   sequence type=CDS   gene model=Glyma20g06571   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAAGTGTTTTACATCGGTGAGAGTGAGAAGTGCGTGGAGGACGATGAATCACGCGTTCCGATTCACATCGTGACCGCGGCGTCACAACTTCCCGTCGACTTTCTGGAACCCTCGCCTCAATCCAAGCTCGTCATCGACTTTGATTGCGAGGGCGTTGACCTGTGTCGCAAAGGCACTCTCTGCGTAATGCAGCTTGCATTTTCGGATGCTGTGTACTTGGTTGATGCGATTGAAGGGGGAGAGGAGCTTAGCATAGCGTGTAAGCTTGCACTTGAGTCTAATTACATCACAAAAGTGATTCATGATTGCAAACGGGACAGTGAGGTCTCCGATTTATTTGATTGCTTGCTTCCTTGCTTGCCCTGGTCCCTCTTTTGTATATGTTGA
Predicted protein sequences of Glyma20g06571
>Glyma20g06571.1   sequence type=predicted peptide   gene model=Glyma20g06571   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEVFYIGESEKCVEDDESRVPIHIVTAASQLPVDFLEPSPQSKLVIDFDCEGVDLCRKGTLCVMQLAFSDAVYLVDAIEGGEELSIACKLALESNYITKVIHDCKRDSEVSDLFDCLLPCLPWSLFCIC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo