|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT2G29890 | AT | Annotation by Michelle Graham. TAIR10: villin-like 1 | chr2:12744597-12749474 FORWARD LENGTH=909 | SoyBase | E_val: 6.00E-15 | ISS |
| GO:0000226 | GO-bp | Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization | SoyBase | N/A | ISS |
| GO:0000911 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation | SoyBase | N/A | ISS |
| GO:0006306 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA methylation | SoyBase | N/A | ISS |
| GO:0006342 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing | SoyBase | N/A | ISS |
| GO:0006346 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methylation-dependent chromatin silencing | SoyBase | N/A | ISS |
| GO:0007010 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization | SoyBase | N/A | ISS |
| GO:0007015 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin filament organization | SoyBase | N/A | ISS |
| GO:0009965 | GO-bp | Annotation by Michelle Graham. GO Biological Process: leaf morphogenesis | SoyBase | N/A | ISS |
| GO:0016246 | GO-bp | Annotation by Michelle Graham. GO Biological Process: RNA interference | SoyBase | N/A | ISS |
| GO:0016569 | GO-bp | Annotation by Michelle Graham. GO Biological Process: covalent chromatin modification | SoyBase | N/A | ISS |
| GO:0016572 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone phosphorylation | SoyBase | N/A | ISS |
| GO:0022402 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cell cycle process | SoyBase | N/A | ISS |
| GO:0030835 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of actin filament depolymerization | SoyBase | N/A | ISS |
| GO:0031047 | GO-bp | Annotation by Michelle Graham. GO Biological Process: gene silencing by RNA | SoyBase | N/A | ISS |
| GO:0031048 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chromatin silencing by small RNA | SoyBase | N/A | ISS |
| GO:0042127 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of cell proliferation | SoyBase | N/A | ISS |
| GO:0045010 | GO-bp | Annotation by Michelle Graham. GO Biological Process: actin nucleation | SoyBase | N/A | ISS |
| GO:0048523 | GO-bp | Annotation by Michelle Graham. GO Biological Process: negative regulation of cellular process | SoyBase | N/A | ISS |
| GO:0051225 | GO-bp | Annotation by Michelle Graham. GO Biological Process: spindle assembly | SoyBase | N/A | ISS |
| GO:0051258 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein polymerization | SoyBase | N/A | ISS |
| GO:0051322 | GO-bp | Annotation by Michelle Graham. GO Biological Process: anaphase | SoyBase | N/A | ISS |
| GO:0051567 | GO-bp | Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation | SoyBase | N/A | ISS |
| GO:0005737 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm | SoyBase | N/A | ISS |
| GO:0015629 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: actin cytoskeleton | SoyBase | N/A | ISS |
| GO:0003779 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: actin binding | SoyBase | N/A | ISS |
| GO:0051015 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: actin filament binding | SoyBase | N/A | ISS |
| PTHR11977 | Panther | VILLIN | JGI | ISS | |
| PTHR11977:SF9 | Panther | FLIGHTLESS-1-RELATED | JGI | ISS | |
| UniRef100_B9SI12 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Villin 1-4, putative n=1 Tax=Ricinus communis RepID=B9SI12_RICCO | SoyBase | E_val: 3.00E-16 | ISS |
| UniRef100_UPI000233910C | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233910C related cluster n=1 Tax=unknown RepID=UPI000233910C | SoyBase | E_val: 2.00E-26 | ISS |
|
Glyma20g05250 not represented in the dataset |
Glyma20g05250 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.20g038300 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g05250.1 sequence type=CDS gene model=Glyma20g05250 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCCTATTGTCACTGAAGATATGGATTCTGCATTCCAAACTGCAGGAGCAAACCCAGGCTTAGAAGTTTGGTGTATTGAGAACCAGCGGCTGGTTTCAGTGTCAAATTCAAGCCATGGAAAATTGTATACTGGAAGTGCATACTTAGTCTTTAATACCTTTTTACATGTTTGTGGAAACATGTAA
>Glyma20g05250.1 sequence type=predicted peptide gene model=Glyma20g05250 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MPIVTEDMDSAFQTAGANPGLEVWCIENQRLVSVSNSSHGKLYTGSAYLVFNTFLHVCGNM*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||