|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G76990 | AT | Annotation by Michelle Graham. TAIR10: ACT domain repeat 3 | chr1:28933387-28935179 FORWARD LENGTH=453 | SoyBase | E_val: 3.00E-35 | ISS |
GO:0006807 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nitrogen compound metabolic process | SoyBase | N/A | ISS |
GO:0008152 | GO-bp | Annotation by Michelle Graham. GO Biological Process: metabolic process | SoyBase | N/A | ISS |
GO:0019243 | GO-bp | Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate | SoyBase | N/A | ISS |
GO:0019344 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process | SoyBase | N/A | ISS |
GO:0005829 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: cytosol | SoyBase | N/A | ISS |
GO:0008773 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: [protein-PII] uridylyltransferase activity | SoyBase | N/A | ISS |
GO:0016597 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: amino acid binding | SoyBase | N/A | ISS |
PF01842 | PFAM | ACT domain | JGI | ISS | |
UniRef100_B9S2P0 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Amino acid binding protein, putative n=1 Tax=Ricinus communis RepID=B9S2P0_RICCO | SoyBase | E_val: 3.00E-36 | ISS |
UniRef100_I1JYZ0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JYZ0_SOYBN | SoyBase | E_val: 9.00E-42 | ISS |
Glyma20g05065 not represented in the dataset |
Glyma20g05065 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.20g037500 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma20g05065.1 sequence type=CDS gene model=Glyma20g05065 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGCTAAAGTTTGTTGGCCATATTTTGATCCTGAGTATGAGAACTTCACCAATAGAATGAACCCTCCAAGGGTCTCTGTGGACAATGCTAGTTTCCATGACTGTACATTGATTAAGATGGATAGTGTTAACAAACCTGGAATTCTGCTGGAAGTTGTCCAAATCTTGACAGACCTTGACTTCATAATTACCAAAGCTTACATATCTTCTGATAGGGGTATTGTTAGAATGGCAAGTGTACCAATTCGCACAAGTAGTATAAAACGGTAA
>Glyma20g05065.1 sequence type=predicted peptide gene model=Glyma20g05065 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MAKVCWPYFDPEYENFTNRMNPPRVSVDNASFHDCTLIKMDSVNKPGILLEVVQILTDLDFIITKAYISSDRGIVRMASVPIRTSSIKR*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||